KEGG   Geobacillus sp. Y412MC61: GYMC61_0926Help
Entry
GYMC61_0926       CDS       T01101                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gyc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
923671..924255
Genome map
AA seq 194 aa AA seqDB search
MIEFIRGYVDYVCPEYIVIDHNGIGYEIFTPNPFAFQESREAAVTVYTYEYVREGVHALY
GFPTREERNLFAKLLQVSGIGPKGGLAILAAGRPDELARAIEEENEAFLCKFPGVGKKTA
RQMILDLKGKLGALAAPAAARSAAPLSGALAEAVAALKALGYAEREIEKIIPALRKEAMS
TEQYVKRALALLLG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgagtttatccgtgggtatgtcgattacgtctgcccggaatatatcgtcatcgac
cataacggcatcggctacgagatctttacgccgaacccgtttgcgtttcaggaaagccgc
gaggcggcggtgaccgtctatacatacgaatatgtgcgcgaaggtgtgcacgccttgtac
gggttcccaacgcgcgaggagcgcaacttgttcgccaagctgctgcaagtgtcgggcatc
gggccgaaaggcggcctcgccattttggcggccgggcgtccggatgaactggcgcgggcc
atcgaggaagaaaacgaggcgtttttatgcaagtttccaggcgtgggcaaaaagacggcc
cggcaaatgattttggatttaaaagggaagctcggggcgcttgcggcgccggcggctgca
cgttcggccgcaccgctttccggtgcgctcgccgaggcggtggcggcgctcaaggcgctc
ggctacgctgaacgggagatcgagaaaatcattccggcgctccgcaaagaagcgatgtcg
acggaacagtatgtgaagcgggcgctggcgctgcttttgggataa

DBGET integrated database retrieval system