KEGG   Geobacillus sp. Y412MC61: GYMC61_0956Help
Entry
GYMC61_0956       CDS       T01101                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gyc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
957434..959794
Genome map
AA seq 786 aa AA seqDB search
MQEQQILALDGRTFIKGVCLAVIFHNEETLYTVVRVRVEETNEAPVEEEVVVTGYFPRLN
EGDVYIFYGQFRQHPRFGRQYAASQFRKQLPNTKEGVIHYLSSGLFKGIGKKTAAAIVET
LGENAIAAILRDPKALERVPKLTKKKAKQLYDALRAHEGLEQTMIALAQLGFGPQLAMKI
YQAYGEEAIDIIHENPYQLVEDIEGIGFGRADEIGRQLGISGSHPARLRAASLFVLEQAC
LQEGHVYLREEELMERIGELLDGRLSGAVDGRAISQTLLMLSEEGKLIAEQGRYYLPSLY
FAEKGIVSNIKRLLGQTPPSAFAESEFLLALGALEERLGMQYAPQQREAIQQALSSPLFI
LTGGPGTGKTTVIKGIVELFAALNGLSIDPADYKQGEPFPVLLAAPTGRAAKRMSEATGL
PAATIHRLLGWNGAEGFSRDENEPISGKLLVIDEMSMVDTWLANQLLKAVPNGMQVIFVG
DEDQLPSVGPGQVLKDLLSSGVIPFARLTEVYRQAEGSSIIELAHKMKRGVVPDDLTAPK
ADRSFIRCRAGQVVDVVRQIADNARKKGFSVKDIQVLAPMYRGPAGIDQLNKALQELFNP
PAEGKRELSVGEVVYRVGDKVLQLVNQPEDNVFNGDIGEIVAIFYAKENIEKQDLLVVSF
DGIEVTYTRQDLGQITHAYCCSVHKAQGSEFPIVILPVVKNYYRMLKRNLLYTAVTRSKQ
FLVLCGEEEAFRFGVAKQSDGARQTALAEKLAGAAAPFVEVELPFEEANMGMENVTPYDF
MGDEPS
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagagcaacaaatcctcgcccttgacggacgcacgttcattaaaggagtgtgcttg
gcggtcatttttcataatgaggaaacattgtacacggtcgtccgcgtgcgcgttgaggaa
acgaacgaagcgcccgttgaggaggaagtcgtcgtcaccggctattttccgcgtttaaac
gaaggggacgtctacatcttttacggacaattccgccaacatccgcgttttggccgccaa
tatgcggctagtcagttccgcaaacagcttccgaacacgaaagaaggagtcattcattat
ttatcgagcggtttgtttaaaggaatcggcaaaaaaacggctgcggcgattgtcgagacg
ctcggcgaaaacgcgatcgccgcgattttgcgcgaccccaaggcgctagagcgtgtgccg
aagctgacgaaaaaaaaggcgaagcagctgtacgatgcgcttcgcgcccacgaagggctt
gagcaaacgatgatcgccctcgcccagctcggttttggcccgcagctggccatgaaaatt
taccaagcgtatggcgaagaagcgattgacatcatccacgagaacccgtaccagctcgtt
gaggatatcgaagggatcggctttggccgcgctgatgaaatcgggcgccagctcggcatt
tccggcagccatccggcccggctgcgcgccgcctcgttgtttgttcttgaacaggcgtgc
ttgcaggaagggcacgtttatttgcgcgaggaagagctgatggagcgcatcggggagctg
cttgacggaaggctgagcggtgcggtggatggacgagcgatcagccaaacgcttctgatg
ttaagcgaggaagggaagctgatcgccgagcaagggcgttattatctcccttccctttac
ttcgccgagaaagggatcgtctccaacattaagcggctgctcgggcagacgccgccgtcg
gcgtttgccgagtcggagtttttgctggcgcttggggcgcttgaggaacggcttggcatg
caatatgccccccagcaaagggaagcgatccaacaagcgctttcttcgccgctgtttatt
ttgaccggcggtccgggaacggggaaaacgacggtcatcaaaggcatcgtcgagctgttt
gccgccctaaacggcctgtctattgacccggctgactacaaacaaggcgagccgtttccg
gtgctgctggccgcaccgaccggccgagcggcgaagcggatgagcgaggcgaccgggctg
ccggcggcgacgatccaccgcttgctcggctggaatggggcggaagggttcagccgcgac
gagaacgaaccgatttccggcaagctgcttgtcatcgatgagatgtcgatggtcgacacg
tggctcgccaaccagctgttaaaagccgtgccaaacggcatgcaagtcattttcgtcggc
gatgaggatcaattgccatccgtggggccagggcaagtgctgaaagacttgctctcttca
ggcgtcattccgttcgctcggttgaccgaggtgtatcgccaggcggaaggatcatcgatc
atcgagcttgctcataagatgaagcgcggcgtcgtgccggacgatttgaccgctccgaag
gcagaccgttccttcatccgctgccgtgcgggccaggtcgtcgatgtcgtgcggcaaatc
gcggacaacgcgcgcaaaaaagggttttccgtcaaagatattcaagtgctcgccccgatg
taccgtggtccagcgggcattgaccaattgaacaaggcgcttcaagagctgttcaacccg
ccggctgaggggaagcgggagctgtcggtcggtgaggtcgtctaccgcgtcggcgataag
gtgctgcagctcgtcaatcaaccggaagacaatgtgtttaacggcgacatcggcgaaatc
gttgccattttttacgccaaagaaaatatcgaaaagcaagacttgctcgtcgtctcgttt
gatggcattgaagtgacgtacacacggcaagatttaggacaaatcacccatgcgtactgc
tgttcggttcataaggcgcaaggaagcgagtttccaatcgtcattttgcccgtcgtcaaa
aactattaccggatgttgaaacggaatttgttgtatactgcggtgacaagaagcaagcag
tttctcgttttatgcggggaagaggaagcgtttcgattcggcgtcgcaaaacaaagcgac
ggagcgcgccagacggcgctcgctgagaagctggcgggggcggcggcgccgtttgtcgag
gtcgaactgccgtttgaagaggcgaacatggggatggaaaacgttacgccgtatgacttt
atgggcgatgagccaagctaa

DBGET integrated database retrieval system