KEGG   Geobacillus sp. Y412MC61: GYMC61_1242Help
Entry
GYMC61_1242       CDS       T01101                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC61_1242
   00030 Pentose phosphate pathway
    GYMC61_1242
   00051 Fructose and mannose metabolism
    GYMC61_1242
   00052 Galactose metabolism
    GYMC61_1242
   00500 Starch and sucrose metabolism
    GYMC61_1242
   00520 Amino sugar and nucleotide sugar metabolism
    GYMC61_1242
  Nucleotide metabolism
   00230 Purine metabolism
    GYMC61_1242
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GYMC61_1242
Enzymes [BR:gyc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     GYMC61_1242
    5.4.2.8  phosphomannomutase
     GYMC61_1242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1265761..1267170
Genome map
AA seq 469 aa AA seqDB search
MNTSTTKPFAWPAHVFKEYDIRGRAGEELDESFAYWLGRAFADMMQKEGEKRAVVGHDNR
LSSPGLHRALKDGLLDGGCDVVDIGLSTTPMFYYSLYYTNIPCGMIITASHNPGDENGFK
IAMGKTTIYGERIQALRRAMERFSQEQPRPETARGREETLDLAPAYIKMLKEKIKLGPRK
LKVVVDCGNGTPSIIAPQVLKEWGCDVIPLYCESDPTFPNHHPDPVVPENLTDLIEMVRK
EQADLGIAFDGDGDRIGVVDETGAIRWGDQLMVLFWREILKRHPGADAPVEVKCSQALVE
EIERLGGKPFFHRTGHSHVKATLRRRPEIPFAGEMSGHLFFNDEFYGYDDALYAAGRLLR
LLSHDERPLSEWFADVPRYAATPETRVACPEEKKPAAIAAVKNRFAGRYPVVDVDGARIQ
FPEGWGLVRPSNTQPILVLRAEAKTEAALAEIKRQLADCLATLELRIDW
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgtcaacaacgaaaccgttcgcatggccggcacacgtgtttaaagaatacgac
atccgcggacgagccggtgaggagctcgatgagtcgttcgcgtattggctcggacgggcc
tttgccgacatgatgcaaaaggaaggcgagaagagggcggttgtcggtcatgacaatcgt
ctgtcatcgcctggcttgcatcgggcgctcaaagatgggctgctcgatggcggctgcgat
gtcgtcgatattggactttcgacgacgccgatgttttactacagcttatactacacgaac
attccatgcggcatgatcatcaccgccagccataacccaggggatgagaacggatttaaa
atcgccatggggaaaacgacaatttatggcgagcgcatccaggcgctgcggcgggcgatg
gagcggttcagccaggaacagccgcgtcctgaaacagcgcgggggcgcgaggaaacgctt
gaccttgctccggcatatatcaagatgttgaaggagaaaattaagcttggtccgcgcaag
ctgaaggtcgtcgtcgactgcggcaacggcaccccatcgatcattgcgccacaagtgctc
aaagagtggggatgcgatgtcatcccgctttactgtgaatccgatccgacgtttccgaat
catcatccggacccggtcgtgccggagaacttaacggacttgattgagatggtgcgcaag
gagcaggctgatcttggcatcgcgtttgacggcgacggcgaccggatcggagtcgtggat
gaaacgggtgcgatccgttggggcgaccaactgatggtgttgttctggcgcgagattctt
aagcgccatccgggagccgacgcgcccgtcgaagtgaaatgttcgcaagcgctcgttgag
gaaattgagcggctcggcgggaaaccgttcttccatcgcaccggccattcgcacgtcaaa
gcgacgttgcgccgtcgtccggagatcccgtttgccggtgaaatgtctggtcatttgttc
ttcaatgatgagttttacggctatgacgatgcgctgtacgccgctgggcgcctgcttcga
ttactgtcgcacgatgagcgcccgctgtccgagtggtttgccgatgtgccgcggtacgcg
gcgacgccggagacgcgcgttgcttgcccggaagagaaaaaaccagctgccattgccgcg
gtgaaaaaccggttcgctggccgctatccggttgttgacgttgatggcgcccgcatccag
ttcccggaaggctgggggttggtgcggccgtcgaacacgcagccgattctcgtcttgcgt
gcagaagccaagacggaggctgcattggcggagattaagcggcagttggctgattgcctc
gccacccttgaattgcgcattgactggtga

DBGET integrated database retrieval system