KEGG   Geobacillus sp. Y412MC61: GYMC61_1242Help
Entry
GYMC61_1242       CDS       T01101                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
gyc00010  Glycolysis / Gluconeogenesis
gyc00030  Pentose phosphate pathway
gyc00051  Fructose and mannose metabolism
gyc00052  Galactose metabolism
gyc00230  Purine metabolism
gyc00500  Starch and sucrose metabolism
gyc00520  Amino sugar and nucleotide sugar metabolism
gyc00521  Streptomycin biosynthesis
gyc01100  Metabolic pathways
gyc01110  Biosynthesis of secondary metabolites
gyc01120  Microbial metabolism in diverse environments
gyc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC61_1242
   00030 Pentose phosphate pathway
    GYMC61_1242
   00051 Fructose and mannose metabolism
    GYMC61_1242
   00052 Galactose metabolism
    GYMC61_1242
   00500 Starch and sucrose metabolism
    GYMC61_1242
   00520 Amino sugar and nucleotide sugar metabolism
    GYMC61_1242
  Nucleotide metabolism
   00230 Purine metabolism
    GYMC61_1242
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GYMC61_1242
Enzymes [BR:gyc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     GYMC61_1242
    5.4.2.8  phosphomannomutase
     GYMC61_1242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: ACX77893
JGI: GYMC61_1242
Position
1265761..1267170
Genome map
AA seq 469 aa AA seqDB search
MNTSTTKPFAWPAHVFKEYDIRGRAGEELDESFAYWLGRAFADMMQKEGEKRAVVGHDNR
LSSPGLHRALKDGLLDGGCDVVDIGLSTTPMFYYSLYYTNIPCGMIITASHNPGDENGFK
IAMGKTTIYGERIQALRRAMERFSQEQPRPETARGREETLDLAPAYIKMLKEKIKLGPRK
LKVVVDCGNGTPSIIAPQVLKEWGCDVIPLYCESDPTFPNHHPDPVVPENLTDLIEMVRK
EQADLGIAFDGDGDRIGVVDETGAIRWGDQLMVLFWREILKRHPGADAPVEVKCSQALVE
EIERLGGKPFFHRTGHSHVKATLRRRPEIPFAGEMSGHLFFNDEFYGYDDALYAAGRLLR
LLSHDERPLSEWFADVPRYAATPETRVACPEEKKPAAIAAVKNRFAGRYPVVDVDGARIQ
FPEGWGLVRPSNTQPILVLRAEAKTEAALAEIKRQLADCLATLELRIDW
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgtcaacaacgaaaccgttcgcatggccggcacacgtgtttaaagaatacgac
atccgcggacgagccggtgaggagctcgatgagtcgttcgcgtattggctcggacgggcc
tttgccgacatgatgcaaaaggaaggcgagaagagggcggttgtcggtcatgacaatcgt
ctgtcatcgcctggcttgcatcgggcgctcaaagatgggctgctcgatggcggctgcgat
gtcgtcgatattggactttcgacgacgccgatgttttactacagcttatactacacgaac
attccatgcggcatgatcatcaccgccagccataacccaggggatgagaacggatttaaa
atcgccatggggaaaacgacaatttatggcgagcgcatccaggcgctgcggcgggcgatg
gagcggttcagccaggaacagccgcgtcctgaaacagcgcgggggcgcgaggaaacgctt
gaccttgctccggcatatatcaagatgttgaaggagaaaattaagcttggtccgcgcaag
ctgaaggtcgtcgtcgactgcggcaacggcaccccatcgatcattgcgccacaagtgctc
aaagagtggggatgcgatgtcatcccgctttactgtgaatccgatccgacgtttccgaat
catcatccggacccggtcgtgccggagaacttaacggacttgattgagatggtgcgcaag
gagcaggctgatcttggcatcgcgtttgacggcgacggcgaccggatcggagtcgtggat
gaaacgggtgcgatccgttggggcgaccaactgatggtgttgttctggcgcgagattctt
aagcgccatccgggagccgacgcgcccgtcgaagtgaaatgttcgcaagcgctcgttgag
gaaattgagcggctcggcgggaaaccgttcttccatcgcaccggccattcgcacgtcaaa
gcgacgttgcgccgtcgtccggagatcccgtttgccggtgaaatgtctggtcatttgttc
ttcaatgatgagttttacggctatgacgatgcgctgtacgccgctgggcgcctgcttcga
ttactgtcgcacgatgagcgcccgctgtccgagtggtttgccgatgtgccgcggtacgcg
gcgacgccggagacgcgcgttgcttgcccggaagagaaaaaaccagctgccattgccgcg
gtgaaaaaccggttcgctggccgctatccggttgttgacgttgatggcgcccgcatccag
ttcccggaaggctgggggttggtgcggccgtcgaacacgcagccgattctcgtcttgcgt
gcagaagccaagacggaggctgcattggcggagattaagcggcagttggctgattgcctc
gccacccttgaattgcgcattgactggtga

DBGET integrated database retrieval system