KEGG   Geobacillus sp. Y412MC61: GYMC61_1467Help
Entry
GYMC61_1467       CDS       T01101                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GYMC61_1467
Enzymes [BR:gyc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     GYMC61_1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1493318..1494757
Genome map
AA seq 479 aa AA seqDB search
MNEGQRTVVIIGGGITGLTAAYYLQKAIREQRLPLACKLVEATHRLGGKVQTVVRDGFVI
ERGPDSFLARKTSAFRLVKEVGLEHEIVHNATGTSYILVNGKLYPIPGGAVMGIPTRIAP
FLTTGLFSPAGKLRAALDFVLPPVKVDGDMPLGRFFRRRLGDEVVDNLIEPLLSGIYAGD
IDEMSLMATFPQFFQLEQKYGSLVRGARRTTPKEQKERKGAFQTLKTGLQSLVDEVEKRL
EPGSVIKGVRVERIVRTDSAYRLQLSTGDVWGADGIIVTTPHHVVPDMFADYPFFAPFRS
VPLTSVATVALAFPEEAIRQDIDGTGFVVSRRSDYTMTACTWTHKKWPHTAPPGKALLRC
YVGRPGDEEIVDQPDDEIVRVVLDDLNKVMNIAGQPEFAVISRWKRAMPQYTVGHRERLA
HIKRQMGDALPGVFLAGSSYEGLGLPDCIDQGEKAVRDVLLYLQQAPVQQTSDLYSSVR
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagggcaacggacggtcgtcatcatcggcggcggcattaccggcttgacggct
gcttactacttgcaaaaagcgattcgagagcaacgcctcccacttgcatgcaaacttgtc
gaggcgacgcaccggctcggcggaaaagtgcagacggtcgtccgcgacggttttgtcatt
gaacgcggtccagactcgtttttggcgcggaaaacgagcgcgtttcgccttgtgaaggaa
gtcggccttgaacatgagatcgttcataacgcgaccggaacatcgtacattttggtcaac
ggcaaactctatccaattccgggcggagcggtgatgggcattccgacgcgcatcgccccg
tttttaacgaccggactgttttccccggccggcaagctgcgggcggcgcttgactttgtg
ctgccgccggtgaaagtcgatggtgatatgccgcttggccgcttcttccgccgccgcctc
ggcgatgaggtggtggacaatctcatcgaaccgctgctttccggcatttacgccggcgac
attgatgagatgagcctaatggcgacgtttccacagttttttcagcttgagcaaaaatac
ggaagccttgtccgtggagcgagacgaacgacgccgaaagagcaaaaagagcggaaaggg
gcgttccagacgttaaaaacgggcttgcagtcgctcgttgatgaagtggaaaaacggctt
gagccgggcagcgtcatcaaaggggtgcgtgtcgagcggatcgttcgcaccgattcggcg
tatcggctgcaactgagcacaggagatgtgtggggggcagacggcatcatcgtgacaacg
ccgcatcatgttgtgcccgacatgtttgctgactatccgtttttcgccccgttccgttca
gtgccgctgacgtcggtggcgacggtggcgctcgcatttccggaggaggcgatccgccaa
gacattgacggcaccgggtttgtcgtttcgcgccgcagcgattacacgatgacagcgtgc
acatggacgcataaaaaatggccgcacacggcgccgcctggcaaggcgctcttgcgctgc
tacgtcgggcgcccgggcgatgaggagatcgtcgaccaacctgatgatgagatcgtccgt
gttgtattggatgatttaaataaagtgatgaacatcgccggccaaccggagttcgccgtc
atctcgcgctggaagcgggccatgccgcaatacacggtcgggcaccgcgagcggctggcg
cacattaaacggcagatgggcgatgcgctgccgggggtgtttttggccggcagctcatac
gaagggctcggattgccggattgcattgaccaaggcgaaaaagcggtgcgtgacgtgctt
ctgtatttgcagcaagcgccagttcaacagacgtccgatctgtacagcagcgtccgttaa

DBGET integrated database retrieval system