KEGG   Geobacillus sp. Y412MC61: GYMC61_1480Help
Entry
GYMC61_1480       CDS       T01101                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYMC61_1480
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GYMC61_1480
Enzymes [BR:gyc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     GYMC61_1480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1505333..1506619
Genome map
AA seq 428 aa AA seqDB search
MASFAERVRQLEESWKNEERWEGIVRPYSAEDVIKLRGSLDIEYTLARRGAEKLWKLLHT
EDYVAALGALTGNQAVQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPSNSVPHVVK
RINQALQRADQIQYLEGSGDVDYFVPIVADAEAGFGGQLNVFELMKAMIEAGAAGVHFED
QLSSEKKCGHLGGKVLLPTQTAIRNLIAARLAADVMGVPTVLIARTDANAADLITSDIDP
RDQAFITGERTPEGFYRTRAGLDQAIARGLAYAPYADLIWCETSEPNLDEARRFAEAIHE
KFPGKLLAYNCSPSFNWKKKLDDETIAKFQQELGKMGYKFQFVTLAGFHALNYSMFELAR
GYKERGMAAYAELQQAEFAAEKYGYTATRHQREVGTGYFDEVAQVISGGQSSTVALKGST
EEEQFTTA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcatttgctgaacgtgtccggcaattagaagaaagttggaaaaacgaggagcgc
tgggaagggatcgtccgtccgtacagcgcggaggatgtcattaaactgcgcggctcgctt
gacatcgagtatacgctcgctcgacgcggggcggaaaaattatggaagctgcttcataca
gaggattacgtcgcggcccttggcgcgctgaccggaaatcaggcggtgcagcaagtgaaa
gcaggcttgaaggcgatttatttaagcggctggcaagtggcggccgacgccaacctcgct
ggacagatgtatccggaccaaagcctgtatccgtccaacagcgttccgcatgtcgtcaag
cgaatcaatcaagcgttgcagcgcgcggatcaaattcaatacttagaaggcagcggggac
gtggactactttgtgccgatcgtcgctgacgccgaggcgggattcggcggccaactgaac
gtctttgagctcatgaaggcgatgattgaggccggagcggctggcgtccattttgaagac
cagctgtcatcggagaaaaaatgcggccatttaggcggcaaagtgcttttgccgacgcaa
acggcgattcgcaacttgatcgcggcgcggttggccgccgatgtcatgggggttccgacg
gtgctcatcgcacgcaccgacgcgaacgctgctgacttgatcacaagcgacatcgacccg
cgcgatcaagcgtttatcaccggggaacggactccggaagggttttatcgcacaagagcc
ggtttggatcaagcgatcgcccgcgggcttgcctatgcgccatatgccgacctcatttgg
tgcgagacgagcgagccgaatttggatgaggcgcgccgatttgccgaagccatccatgag
aaattcccaggcaagctgctggcgtacaactgctcgccgtcgttcaactggaagaaaaaa
ttggacgacgaaacgatcgccaaattccagcaagagctcggcaaaatgggatacaagttc
caatttgtcaccttggctggcttccatgcgctcaactacagcatgttcgaactggcgcgc
ggctacaaagagcgaggcatggcggcgtacgccgagctgcagcaagcggaatttgccgcc
gagaagtacggctacacggcgacgcgccatcagcgcgaagtcggcacgggctatttcgac
gaagtcgcccaagtgatctctggcggccaatcgtcaacagtcgctttgaaaggatcgacc
gaagaagaacagtttacgacagcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system