KEGG   Geobacillus sp. Y412MC61: GYMC61_1505Help
Entry
GYMC61_1505       CDS       T01101                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GYMC61_1505
Enzymes [BR:gyc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     GYMC61_1505
Peptidases [BR:gyc01002]
 Cysteine Peptidases
  Family C44
   GYMC61_1505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1533974..1535821
Genome map
AA seq 615 aa AA seqDB search
MCGITGWVHFGRNLRRERTVIDSMTETLAKRGPDDTNTWLDTHVAFGHKRLVVVDPAGGK
QPMVRQKNGHRYTIVYNGELYNTEDIRKELLRQGYRFDGHSDTEVLLAAYMEWKEKCVDW
LNGIFAFAVWDEERELLFMARDRLGVKPLFYREDGEGLLFGSEVKAILAHPDVKAEVNYE
GLAEVFGLGPSRTPGHGVFDGIRELRPAHALTFSRSGLRIWRYWNVESDVHRDSFEETVE
KLRFLLTDAVTRQLVSDVPVCTFLSGGVDSSAITGIAANAFAADGKGPLHTYSIDYEGND
QYFKANDFQPNTDAPFIEQVSNQFQTVHHRCVITQEELFRHLHEAVIVRDVPGMADVDSS
LLWFCKQIRERFVVSLSGECADEIFGGYPWFHRPDDLSRKGFPWMRSVDARMGLLKDEWR
QKLRLDDYVQMRYEQTLAEVPRLEGESAEEAKRRELFYLNMIWFMTTLLDRKDRMSMGAS
LEVRVPFADHRIVEYVWNIPWDMKMYGGREKGLLRKALEGLLPEEVLYRKKSPYPKTHHP
LYTKLVKQWLEQLLHDRSSVLHEFFDREKLLALIETEGKSFQVPWFGQLMTGPQLLAYLG
QVHVWFDHYGIRIKE
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcattactggctgggtccatttcgggcgcaatttgcgccgcgagcggacggtc
attgacagcatgacagagacgctcgccaaacgtggaccagatgatacaaatacgtggctg
gacactcatgtcgccttcggccataaacggcttgtcgtcgtggatccggctggcggcaaa
caaccgatggtccggcaaaaaaacggacatcgttatacgatcgtctataacggcgagctg
tataatacggaagacattcgcaaggaactgttgcgccaaggctatcgatttgatggtcat
tccgatacagaagtgttgcttgccgcatatatggaatggaaggagaaatgcgtcgattgg
ctcaacggcatttttgccttcgccgtttgggacgaggagcgcgagctgttatttatggcg
cgcgaccggctcggagtaaaacctttgttttatcgagaagatggcgaggggctgctgttc
ggctcggaagtgaaagccattttggcccatcccgatgtaaaggcagaagtcaattatgaa
ggactcgccgaagtgttcggcctcggaccgtcgcgcacaccggggcacggcgtgtttgac
ggcattcgagagctgcgcccggcacatgcgctcacgttctctcgcagcgggcttcgcatt
tggcggtattggaatgtcgaaagcgacgtccaccgcgattcgttcgaggaaacggtcgaa
aagctgcgctttctattgacggatgcggtcacgcgccaactcgtttccgatgtgccggtc
tgcacatttctatccggtggagtcgattcaagcgccattacagggattgccgccaatgcc
ttcgcggcagatggaaaagggccgctgcacacctactcgatcgattatgaaggaaacgac
cagtatttcaaagccaacgattttcaaccaaacacggatgcgccatttatcgaacaggtg
tcaaaccaatttcaaacggttcatcatcgctgcgtgatcacgcaagaagaactgttccgc
catttgcatgaagccgtcatcgtccgcgacgttccgggcatggccgatgtcgattcttcg
cttctttggttttgcaaacaaattcgcgaacggtttgtcgtcagcttatctggggagtgc
gccgatgaaattttcggcggctatccatggtttcatcggccggacgatttgtctcggaaa
ggatttccgtggatgcgttcggtcgacgcgcgcatgggcctattaaaggatgagtggcgg
caaaagcttcgccttgacgactatgtgcaaatgcgttatgaacaaacgcttgctgaagtg
ccgcgtctcgagggggaaagcgccgaggaggcgaagcggcgtgagctgttttacttaaat
atgatttggtttatgacgacactgcttgaccgaaaagaccggatgagcatgggagcaagc
ttggaagtgcgtgtgccgttcgctgaccatcgcattgtcgaatacgtttggaacattccg
tgggatatgaaaatgtacggcggccgagaaaaaggccttttgcgaaaagcgctcgaggga
ttgcttcccgaagaggtgctctaccggaaaaaaagcccatatccgaaaacgcaccatcct
ctatatacgaaacttgtcaagcaatggcttgagcagttgctccatgatcgctcttcggtt
ttgcacgagtttttcgaccgggaaaaattgctggcgctcattgaaacagaagggaagtcg
ttccaagtgccgtggtttgggcagctcatgaccggtccgcagctgctcgcttaccttggc
caagtgcacgtttggtttgatcattacggcattcgcattaaagaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system