KEGG   Geobacillus sp. Y412MC61: GYMC61_1595Help
Entry
GYMC61_1595       CDS       T01101                                 

Definition
acetylglutamate kinase
Orthology
K00930  
acetylglutamate kinase [EC:2.7.2.8]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:gyc01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:gyc01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gyc00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1620509..1621285
Genome map
AA seq 258 aa AA seqDB search
MGKTVVIKCGGSVLDELSPAFFASVNMMREQGMDVVIVHGGGPEIGQMLKKLAVPSEFVN
GLRKTTKEVLAVVEMVLSGKVNKQLVAMLRQNGLPAVGVSGVDGGLLEAEPIDFAKLGYV
GRVKTVRSRLLRTLLEAGYIPVVSPLGIDQNGQTYNINADTAAGAVAAAIGASQLAFVTN
VPGILRDGALVAEATAETIERLIEDRVITGGMIPKVKAALSALSDALPEVMIVSGKTTFY
QNGTWHGTTIRKEVGVYL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaacggtcgtcatcaaatgcggcggcagcgtgctcgatgagctgtctcccgcc
ttttttgccagcgtgaacatgatgcgggaacaagggatggatgtcgtcatcgtccacggc
ggcgggccggaaatcgggcaaatgttgaaaaaactggcggtgccgagcgagtttgtcaac
ggcttgcggaaaacgacgaaagaggtgctggccgttgtggaaatggtgctctccggcaaa
gtgaacaaacagcttgtggcgatgctcaggcagaacggcttgccggcggtcggcgtttcc
ggcgtggacggggggctgctcgaagctgaaccgattgactttgctaaacttggctatgtc
ggccgtgtgaaaacggttcgctcccgtcttttgcgcacgctgcttgaggcgggctacatt
ccggtcgtttcgccgcttggcatcgaccaaaacgggcaaacatacaacattaacgccgac
acggcggctggggcggtcgcggccgccattggcgccagccagctcgcgtttgtgacgaac
gtgcccggcattttgagagacggcgcgctcgtggccgaggcgacggcggaaacgattgaa
cgactgatcgaagaccgcgtcatcacgggcgggatgattccgaaagtgaaagcggcgctg
tccgccctgtccgatgcgctgcccgaggtgatgatcgtcagcggcaaaacgacgttttac
cagaacggaacatggcacggcacaacgattcgcaaagaagtgggggtatatttatga

DBGET integrated database retrieval system