KEGG   Geobacillus sp. Y412MC61: GYMC61_1834Help
Entry
GYMC61_1834       CDS       T01101                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:gyc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gyc00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:gyc00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gyc00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1858363..1859667
Genome map
AA seq 434 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEIL
VPEGTVATVGQTLITLDAPGYENMTFKGQEHEEVKKEEKAETVSKKEMVETAAPSAPAAE
AEADPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRILKEDIDAFLAGGAKAAAEPTPQ
AAEEKAAPQAPAAKPVVPEGEFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDEADVTK
LVAHRKKFKAIAAEKGIKLTFLPYVVKALVSALREYPVLNTSIDDATEEIIHKHYYNIGI
AADTDRGLLVPVIKHADRKPIFALAKEINELAEKAREGKLMPNEMKGASCTITNIGSAGG
QWFTPVINHPEVAILGIGRIAEKPIVRDGEIVAAPVLALSLSFDHRMIDGATAQKALNHI
KQLLSDPELLLMEA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaagctgccggacattggcgaaggcattcacgaaggcgagatcgtc
aaatggttcgtcaagccgggcgatgaagtgaacgaagacgacgtgttgtgcgaagtgcaa
aacgacaaagcggtcgtcgagatcccatctcctgtcaaggggaaagtgcttgagattctc
gtcccggaaggaacggtggcgacggttgggcaaacgctcattacgctcgatgcgccgggc
tatgaaaacatgacgtttaaaggacaagaacacgaagaagtgaaaaaagaggaaaaagcg
gaaacggtgtcgaaaaaggaaatggttgagaccgctgctccgagcgcaccggcggccgaa
gcggaagccgacccgaaccgccgcgtcatcgcgatgccgtctgtgcgcaaatatgcgcgt
gaaaaaggcgtcgatatccgcctcgtccaaggcacggggaaaaacggccgcattttgaaa
gaagatattgatgccttcctcgccggcggcgcgaaagccgcggctgagccgacgccgcaa
gcggcggaagagaaggcagcgccgcaagcgccagcggcgaaaccggttgtgccggaaggc
gaattcccggaaacgcgcgagaaaatgagcggcatccgtcgggcgatcgccaaggccatg
gtgcattcgaaacatacggccccgcacgtgacgctgatggacgaagccgatgtgacgaag
cttgttgctcaccgaaaaaaattcaaggccattgccgcggaaaaaggcatcaagctgacg
ttcttgccgtatgtcgtcaaagcgcttgtttccgcgctgcgtgaatatccggtgctgaat
acgtcgatcgacgatgcgacggaggaaattattcataagcattactacaacatcggcatc
gccgctgatacggatcgagggttgctcgtgccggtcattaaacatgccgaccggaagccg
attttcgcgctggcgaaggaaatcaacgaactcgctgaaaaagcgcgcgaaggcaaactg
atgccaaacgaaatgaaaggcgcatcgtgcacgatcacgaacatcggctcagccggcggg
caatggtttacgccggtcatcaaccatccggaagtggcgattcttggcatcggccgcatt
gcggaaaaaccgatcgtccgcgacggtgaaattgtcgctgctccggtcttggcgctctcg
ttgagctttgaccatcggatgatcgacggagcgacagcgcaaaaagcgctcaaccatatc
aagcagctgttaagcgatccagaattattattaatggaggcgtaa

DBGET integrated database retrieval system