KEGG   Geobacillus sp. Y412MC61: GYMC61_2025Help
Entry
GYMC61_2025       CDS       T01101                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GYMC61_2025
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    GYMC61_2025
Enzymes [BR:gyc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     GYMC61_2025
Two-component system [BR:gyc02022]
 CheA family
  CheA-CheYBV
   GYMC61_2025
Bacterial motility proteins [BR:gyc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    GYMC61_2025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2034929..2035978
Genome map
AA seq 349 aa AA seqDB search
MKTIKVLVVDDSAFMRKWISDFLSEHPRLEVIGTARNGREALEKIAALRPDVVTLDVEMP
VMNGLETLQRIMRDHPVPVVMVSSTTTEGAENTIDAMQYGAVDFVAKPSGPISLDLYKVK
DELIGKVLHASEANVAALTAPRRQRPSWRPSFKAAARPQQAIVAIGTSTGGPRALETVLT
QLPPDLAAPVVAVQHMPKGFTTSLANRLDALAAITVKEAEDGEVLQNGTAYIAPGGVHLI
VREEGGALKARFDESPPRAGHRPAVDVLFESLAAIRRCRKIAVIMTGMGSDGTSGLKKLK
ESGNTKAIAEARETAVVFGMPRAAIEAGVVDVIVPLDSIAAAIVQLIGE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgatcaaggtgcttgtcgtcgatgactcggcgtttatgcgcaaatggatcagt
gattttttgtccgagcatccgcgcctcgaagtcatcggaacagctcgcaacggccgggag
gcgctcgagaaaatcgctgccctaaggccggatgtcgtgacgcttgatgtggaaatgccg
gtcatgaacggactcgaaacgttgcagcgcatcatgcgggaccatcccgtgccggtcgtc
atggtgtcaagcacgacgaccgaaggggcggaaaacacgatcgacgccatgcagtacggg
gcggtcgactttgtcgctaagccgtccggaccgatttcgctcgatttgtacaaagtgaaa
gacgagctgattggcaaagtgctgcacgcgagcgaagcgaacgtggctgccttgactgcc
ccgcgccgccaacgtccgtcttggcgcccatcgttcaaagcggcggcgcggccgcaacag
gccatcgtcgcgatcggcacttccaccggcggcccgcgcgcgctcgagacggtgctgacg
cagcttccgcccgatctagccgctccggtcgtcgctgtccagcatatgcccaaaggattt
acgacatcgctcgccaaccggcttgatgcgcttgccgcgatcacggtcaaggaggcggaa
gacggggaagtgctgcaaaatggcaccgcctatatcgcgccaggcggtgtccatctcatc
gttcgcgaagaaggcggcgcgcttaaagcccgtttcgacgaatcgccgccgcgcgccggc
catcgtccggctgttgacgtgttgttcgagtcgctcgctgccattcgccgctgtcggaaa
atcgcggtgatcatgaccgggatgggaagcgacggaacatcggggttgaaaaagctgaag
gaaagcgggaacacaaaagcgatcgcggaagcgcgcgagacagccgttgtctttgggatg
ccaagagcggcgatcgaggctggcgtcgttgatgtcatcgttccgcttgacagcatcgcc
gctgccatcgtccaattgatcggggagtga

DBGET integrated database retrieval system