KEGG   Geobacillus sp. Y412MC61: GYMC61_2150Help
Entry
GYMC61_2150       CDS       T01101                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    GYMC61_2150 (glpK)
Enzymes [BR:gyc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     GYMC61_2150 (glpK)
Exosome [BR:gyc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GYMC61_2150 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2168441..2169931
Genome map
AA seq 496 aa AA seqDB search
MNQYILAIDQGTTSSRAILFNQKGEIVHMAQKEFTQYFPQPGWVEHNANEIWGSVLAVIA
SVLSEAQVKPEQVAAIGITNQRETTVVWEKDTGNPIYNAIVWQSRQTAGICDELKAKGYD
PLFREKTGLLIDAYFSGTKVKWILDHVEGARERAERGELLFGTIDTWLIWKLSGGRAHVT
DYSNASRTLMFNIHTLEWDDELLAILNVPKAMLPEVRPSSEVYAKTVPHHFFGVEVPIAG
AAGDQQAALFGQACFTEGMAKNTYGTGCFMLMNTGEKAVQSKHGLLTTIAWGIDGKVEYA
LEGSIFVAGSAIQWLRDGLRMIKTAADSEAYAEKVESTDGVYVVPAFVGLGTPYWDSEVR
GAVFGLTRGTTKEHFIRATLESLAYQTKDVLAAMEADSGISLTTLRVDGGAVKNNFLMQF
QSDLLAVPVERPVVNETTALGAAYLAGLAVGYWNSRDDIAAQWQLERRFEPKMDDDKRTM
LYDGWKKAVRAAMAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatacattttagccatcgaccaaggcacaaccagctcgcgcgcgattttgttc
aatcaaaagggcgaaatcgttcatatggcgcaaaaagagtttacgcaatattttccgcag
cccggctgggtcgagcacaacgccaatgaaatttggggatcggtgcttgctgtcattgcc
agcgtcttgtccgaggcgcaagtgaagccggaacaagtggcggcgatcggcattacgaac
cagcgggaaacgacggttgtgtgggagaaagacaccggcaacccgatttacaacgccatc
gtctggcagtcgcggcagacggccggcatttgcgatgaactgaaagcgaaagggtatgac
ccgctattccgcgaaaaaaccggcttgcttattgacgcctatttttccgggacaaaagtg
aaatggattttggaccatgtcgagggggcgcgcgaacgggcggagcgaggagagctgctc
tttggcacgattgatacgtggctcatttggaagctgtccggcggccgcgcccatgtaacc
gattactcgaacgcgtcgcgcacattaatgtttaacattcatacgctcgagtgggatgac
gagctgcttgcgattttaaacgtgccaaaggcgatgcttcctgaggtgcgcccgtcctcg
gaagtatatgcgaaaacggttccgcatcatttctttggtgtggaggtgccgatcgcggga
gccgcgggcgaccagcaggcggctttgttcggccaggcgtgctttacggaagggatggcg
aaaaatacgtacggcaccggctgctttatgctgatgaatacgggggaaaaagcggtgcaa
tcgaaacacgggctgctcacaacgatcgcctggggaattgacggcaaggttgaatacgcc
cttgaaggcagcatcttcgtcgccggttcggccattcaatggctgcgcgacggcttgcgg
atgatcaaaactgcggcggacagcgaagcgtacgccgaaaaagtcgagtcgaccgacggg
gtgtatgtcgtcccagcgttcgtcggcctcggcaccccgtattgggacagcgaagtgcga
ggcgcggtgtttggcctcacgcgcggcacgacgaaagagcatttcatccgggcgacgttg
gaatcgctcgcctaccagacaaaagatgtgcttgccgccatggaagccgattccggcatc
tcgctgacgacgctgcgcgttgacggcggggccgtgaaaaacaacttcctcatgcagttc
cagagcgatttgctggccgttccggttgaacggccggtcgtgaatgaaacgacggccttg
ggcgcggcgtatttggccggattggccgtcggctattggaacagccgggatgacatcgcc
gcccaatggcagcttgagcgccggtttgagccgaagatggatgatgacaagcgaacgatg
ctctacgatggctggaaaaaagcggtgcgggcggcgatggcgtttaaatga

DBGET integrated database retrieval system