KEGG   Geobacillus sp. Y412MC61: GYMC61_2180Help
Entry
GYMC61_2180       CDS       T01101                                 

Definition
type III site-specific deoxyribonuclease (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
gyc  Geobacillus sp. Y412MC61
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2205716..2208670
Genome map
AA seq 984 aa AA seqDB search
MKLKFNADLDYQRRAVESVVHIFKGQELSQSNFTVSYGPDAGMLQTDLGVGNRLDLTPEE
ILKNVQDIQVRNGLPRSERLDGMHFTIEMETGTGKTYVYLRTIYELHKHYGFTKFVIVVP
SVAIREGVYKSLQITRDHFDELYDRTPAEYFIYDSQKLDQVRNFATATTIQIMIINIDAF
RKSFEDPEKEDKANVIHRPNDRLNGYRPIEFIRQTNPIVIIDEPQSVDTTPKSKEAIASL
NPLCTLRYSATHVDKYHMVYRLDAVDAYNQKLVKKIEVMSVRSEPSFNVPYIKLVEVKER
KAKLELDVESRGKIKRTTKTVKYGDDLYDVSGERELYRGYIVEQIDWTEGNEAVEINGYR
LRVGDAIGDVDDDAIKRYQIRKTIEEHLNKELWLRPRGIKVLSLFFIDKVAHYRDYDQNG
NPIKGKYASMFEEEYRNLMQKPKYRPLWDDPGIDQDIEKVHNGYFAQDKKGRLKDTKGNT
EADTDVYNLIMRDKERLLSLDEPLRFIFSHSALREGWDNPNVFQICTLKDSSGTYVSRRQ
EIGRGLRLAVDQNGERVHDDHINILTVMANESYEEFVATLQKEIEEDTGIQFGKIEKHVF
AKLVYVDEATDEPVQMGYDLSLKLYEELKQNGYIDKQGKATEKLKRAIENYDLHLSDEFQ
PWRSSIVKEIKRHLQALPIKDGTKKKKVHVNMAVLNQEEFRRLWDKIKYKTVYSVDFDSE
QLIDLCIAAIQEMRPIEKIRIVSRKGRVEIDHVTGVQAQTISEKVEDYVSLHHTLPDVVT
ELQNRTNLTRKTIVRILTGCKRLDDFKNNPQKFIEEVANIIQRQMRLLLKDGVKYYKIGD
DAYYAVELFQNEELLAYLNDNAIPSEKSPFDHILYDSDVEERFAKRFEHDENVKVYVKLP
SWFKIDTPIGSYNPDWALVIEKDGEEKLYFVLETKGQEWEDELRPGEAAKIAFARKHFQA
LGTDVEFIGPENDVERFMLRALSR
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaagtttaacgcggatttggactaccaacggcgcgcggtggagtcggtggtg
catattttcaaaggacaggaactgagccagtcgaacttcaccgtttcgtacggccctgat
gcgggaatgcttcaaacggacttgggcgtcgggaatcggcttgacctgacgcctgaggaa
attttaaaaaacgtccaagacatccaggtgagaaacggcctgccacgcagcgagcggctc
gatggcatgcattttacgattgaaatggaaacagggacggggaagacgtacgtatatttg
cggacgatttatgagctccataagcattacgggtttacgaaatttgtcatcgtcgtcccg
tcggttgcgattcgcgaaggggtgtacaagtcgctgcaaatcacccgcgaccatttcgat
gaactgtacgaccgcactccggcggaatattttatttacgattcgcaaaagcttgaccaa
gtgcgcaattttgcgacggcgacaacgattcaaattatgatcatcaatatcgatgcgttt
cgcaaaagcttcgaagatccggaaaaggaggataaggcgaacgtcattcatcggccaaac
gatcgtttaaatgggtaccgcccgattgagtttatccgacagacgaatccgattgtcatc
atcgatgaaccgcaaagcgtcgatacgacgccgaagtcgaaggaggcgatcgcgtcgctg
aacccgctttgcacgctgcgctactcggcgacgcatgtggacaagtatcatatggtgtac
cgccttgatgcggttgacgcctataatcaaaagctggtgaaaaaaatcgaagtcatgtcc
gtccgctctgaaccgtcgttcaatgtgccgtacatcaaactcgttgaggtgaaagagcgg
aaagcgaaacttgagctcgatgtcgagtcgcgcgggaagatcaaacggacgacgaaaacg
gtcaaatacggcgatgacttgtatgacgtttcgggggagcgcgaactgtaccgcggctat
atcgtcgagcaaatcgattggacggaaggaaatgaagcggttgaaatcaacggctatcga
ctcagggtgggcgacgcgattggagatgtcgatgacgatgccatcaagcggtatcaaatc
cgcaaaacgattgaagaacatttaaataaggaattgtggctccgcccgcgcgggattaaa
gtattaagtctgttcttcatcgacaaagtcgctcattaccgtgattatgatcaaaacggc
aatccaatcaaaggaaaatatgcgtcgatgtttgaggaagagtatcggaacttaatgcaa
aagccgaaataccgtccgctctgggacgacccgggcattgaccaagatatcgagaaggtg
cataatggctattttgctcaagataaaaaaggacggttgaaagatacgaaagggaataca
gaggcggatacggatgtatacaatctcattatgagggacaaagaacggctgctcagcctc
gatgagccgctccgcttcattttctcccattctgcgctccgtgaaggatgggacaacccg
aacgtcttccaaatttgcacgttgaaagactcgtccggcacgtatgtatccagacgccaa
gaaatcgggcgcggattgcggctggccgtcgatcaaaacggagagcgggtgcatgacgat
catatcaacatattgacggttatggcgaatgagtcatatgaagaattcgtcgctacgttg
caaaaagagattgaagaggatacgggcatccagttcggcaaaatcgaaaaacatgtattt
gccaaactcgtttatgtggatgaggcgacggacgagccggtgcaaatgggttatgattta
tcattgaagctgtatgaggaattaaaacaaaacggctatattgacaaacagggcaaagca
acggaaaaactcaaacgagccattgaaaactatgatctccatctgagcgatgaattccag
ccctggcgatcgtccatcgtgaaagagatcaaacgccatttgcaagcattgccgatcaaa
gatgggacgaaaaagaaaaaagtccatgtcaatatggcagtccttaatcaagaggagttc
aggcggctgtgggataaaatcaaatacaaaaccgtctattccgttgattttgacagcgaa
cagctcattgacctgtgcattgccgccattcaggaaatgaggccgattgagaaaatccgc
attgtcagccgaaaaggacgggtggaaatcgaccatgtgacaggcgtgcaggcgcaaacg
atcagcgaaaaagtggaagattacgtgagcttgcaccatacgctcccggatgttgtcacc
gagctgcaaaaccggacgaatttaacgcggaagacgatcgtgcgcattttgaccggctgc
aagcggctcgatgatttcaaaaacaatccgcaaaagtttattgaagaagtggcgaacatc
atccagcgccaaatgaggctgttgctgaaagatggcgtgaaatattacaaaattggtgat
gatgcgtattacgcggtcgaactgttccaaaacgaagagctgctcgcctatttgaacgac
aacgccatcccgagcgaaaaatcgccgtttgaccatatcctttacgattccgatgtggaa
gagcggttcgccaaacgttttgaacacgatgagaacgtaaaagtgtacgtcaaactgccg
agttggtttaaaattgacacaccgatcggctcctacaatcccgactgggcgcttgtcatc
gaaaaggatggagaggaaaaactgtacttcgtcctcgagacgaaaggacaggaatgggag
gacgaactgcgtcccggtgaagcagcgaaaattgccttcgcccgcaaacactttcaagcc
cttggaacggacgtggaattcatcggaccagagaatgatgtcgagcggtttatgctgcga
gccttaagccgttga

DBGET integrated database retrieval system