KEGG   Geobacillus sp. Y412MC61: GYMC61_2297Help
Entry
GYMC61_2297       CDS       T01101                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    GYMC61_2297
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GYMC61_2297
   00650 Butanoate metabolism
    GYMC61_2297
  Amino acid metabolism
   00360 Phenylalanine metabolism
    GYMC61_2297
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GYMC61_2297
   00622 Xylene degradation
    GYMC61_2297
   00621 Dioxin degradation
    GYMC61_2297
Enzymes [BR:gyc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     GYMC61_2297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2339878..2340777
Genome map
AA seq 299 aa AA seqDB search
MEKINVAILGSGNIGTDLMLKLERSDVLQLTTVIGIDPQSEGLRLAKEKGYHVIDSGIQA
FLEHPEWADFVFDATSAKAHIRHAKLLKQAGKVVFDLTPAAVGPFVVPPVNITEHLEETN
INFITCGGQATIPIVHAIGRVQPVAYAEIVATISSKSAGPGTRANIDEFTETTARGLEKI
GGAKRGKAIIILNPAEPPILMRNTIYALVEGKKAAAREICDSIEEMVETIRSYVPGYRLR
TSPIIEGNKVTVMVEVEGAGDYLPKYAGNLDIMTAAAVKVAEEVAKHRLSKLLAEEGKR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtggagaagatcaatgtagcaattcttggttctgggaacatcgggactgacttgatgttg
aagcttgaacgttcggatgtgttgcagttgacaacagtaattgggatcgatcctcaatcg
gaagggctgcgtctagcaaaagagaaagggtatcacgtcattgacagcggcatccaagcg
tttttggagcatcccgaatgggctgatttcgtcttcgacgcgacgtcggcgaaagcgcac
atccgtcatgccaaactgttgaagcaggctgggaaggtcgtctttgatttgactccggcg
gccgttggaccgtttgttgtgccgcctgtcaatataacggaacatttggaagagaccaac
attaacttcatcacatgcggtggacaggcgacgattccgatcgttcatgccattgggcgc
gtgcagccggtcgcttacgctgaaattgttgcgacgatttcaagcaaaagtgcagggccg
ggaacaagagcgaacattgatgaatttacagaaacgactgctcgagggctcgaaaaaatc
ggtggggcgaagcgcggaaaagccatcattattctcaacccggctgaaccgcccattttg
atgagaaacacaatatacgcacttgtcgaagggaagaaagcagcggcgcgggaaatttgc
gactcgatcgaggaaatggtagaaacgatccgctcgtacgttcccggctatcggctgcgc
acgagtccgatcattgaaggaaataaggtgacggtcatggttgaagtggaaggagcgggt
gattatttgccgaagtacgctggaaacttggatattatgaccgccgctgcggtgaaagtg
gcggaggaagtggcgaagcatcgattatcgaagttgttggctgaggaggggaaacgatga

DBGET integrated database retrieval system