KEGG   Geobacillus sp. Y412MC61: GYMC61_2370Help
Entry
GYMC61_2370       CDS       T01101                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:gyc01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gyc00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:gyc00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2410849..2413032
Genome map
AA seq 727 aa AA seqDB search
MGEYVQKGNIQVAKVLYDFVNEELLPNSGLDQDKFWSDFGALISDLTPRNKELLARRDEI
QEKLNEWHKAHRGRFDFNEYKAFLTDIGYLEPEVEDFAITTDNVDDEIAVQAGPQLVVPL
TNARYALNAANARWGSLYDALYGTDAISEEDGAERGSSYNPVRGAKVIVYGRQFLDEAVP
LAEHSHQDVVQYAVVDGRLVVTTEGGATTGLKEPEKFVGFQGDPQHPTAVLLKNNGLHIE
IQIDREHAVGKTDKAGIKDIVLEAAVTTIMDGEDSVAAVDAEDKVLVYRNLFGLVKGDLT
ATFEKNGKIMTRSLNPDRVYKTPDGGELVLPGRSLMFVRNVGHLMTNNAILHANGEEVHE
GIMDAVITSLIMKHSLIGNTRYLNSRKGSIYIVKPKMHGSAEVAFANELFDRVEDMLGLE
RNTIKIGVMDEERRTSLNLKNCIYQVRDRIIFINTGFLDRTGDEIHTSMEAGPMLRKNEM
KSSTWLQAYEKSNVAVGLAAGFRGRAQIGKGMWAMPDLMAEMLKQKGAQLKAGANTAWVP
SPTAATLHALHYHQVNVSAVQSELANDRNDYRDDMLQIPVVDHPQWTAEEIQEELDNNCQ
SILGYVVRWIDQGIGCSKVPDIHNVGLMEDRATLRISSQILANWLHHGICTKEQVLETLK
RMAKVVDEQNAGDPNYRPMAPNYDDSVAFQAACDLIFRGYEQPNGYTEPILHRRRQEAKA
KFAAIQQ
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaatacgtacaaaaagggaacatccaagtcgccaaagtgttgtacgactttgtc
aacgaggagcttctgccgaacagcgggttggatcaagacaagttttggagcgatttcggc
gcgctcatttccgacttgacgccgcgcaacaaagaattgctcgcccgccgcgacgaaatt
caagaaaaattgaatgagtggcataaagcgcatcgcggccgctttgattttaacgaatat
aaagcatttttgacagacatcggctatttggagccggaagtcgaggactttgcgattacg
accgacaatgtcgacgatgaaattgccgtgcaagccgggccgcagctcgtcgtgccgctc
acgaacgcccgctatgcattaaacgctgccaacgcccgttggggcagcctgtacgacgcg
ctgtacggcaccgatgccatcagcgaggaagacggcgccgagcgcggttcgtcgtacaac
ccggtgcgcggggcgaaagtcatcgtctacgggcggcagtttttggatgaagcagtgccg
cttgccgaacattcccatcaagacgtagtccaatacgcggtcgttgacgggcggctcgtc
gtgacgacagaaggcggggcgacgacggggctgaaagagccagaaaaatttgtcggtttc
caaggcgacccgcaacatccgacagcggtgttgctgaagaacaatggccttcacattgaa
attcaaatcgaccgcgagcatgcggtcggaaaaacggataaagccggcatcaaagacatc
gtgttggaggcggcggtcacgacgatcatggacggcgaagattcggtggcggccgttgac
gccgaagacaaagtgctcgtttaccgcaacttgtttggtctcgttaaaggcgatttgaca
gcgacatttgagaaaaacggcaaaatcatgacgcgctccctgaacccggatcgcgtatac
aaaacgccggatggcggggagctcgtgctgccgggccgttcgctcatgttcgtgcgcaac
gtcgggcacttaatgacgaacaacgcgatcttgcatgcgaatggcgaggaagtgcatgaa
gggatcatggacgccgtcattacaagcttgattatgaaacattcgctcatcggcaataca
cgctacttgaattcgcgcaaaggttccatctacatcgtcaagccgaaaatgcacggatcg
gcggaagtggcgtttgccaacgagctgtttgaccgcgtcgaagacatgctcggccttgag
cggaatacgattaaaatcggcgtgatggacgaggagcgccgcacgtcgctcaacttgaaa
aactgcatctaccaagtgcgcgaccgcatcatttttatcaacaccggcttcctcgaccgg
accggagacgaaattcatacgtcgatggaagcggggccgatgctgcgcaaaaacgagatg
aaatcatcgacttggctgcaggcgtatgaaaaatcgaacgtcgccgttgggcttgccgcc
ggcttccgcggccgggcgcaaatcggcaaaggaatgtgggcgatgccggatttgatggca
gaaatgctgaagcaaaaaggagcgcagctcaaagcaggcgccaatacggcatgggtgccg
tcgccgacagcggccacgctccatgcgcttcattaccatcaagtgaacgtctccgctgtg
caaagcgaactggcgaacgatcggaacgattatcgcgacgacatgttgcaaatcccggtc
gttgaccacccgcaatggacagcggaagagattcaagaagagctcgacaacaactgccaa
agcattttaggctatgtcgtccgctggatcgaccaagggatcggctgctcgaaagtgccg
gacattcacaacgtcggactgatggaagaccgggcgacgcttcgcatctcgagccaaatt
ctcgccaactggctccatcatggcatttgcacgaaagagcaagtgcttgagacgctcaag
cggatggcaaaagtcgtcgacgaacaaaacgccggcgatccgaactatcgtccgatggcg
ccgaattacgatgattcggtggcgttccaagcggcatgcgatctcattttccgcggctat
gaacagccaaacggctataccgagccgattttgcaccgccgccgtcaagaagcaaaagcg
aaatttgccgccattcagcaataa

DBGET integrated database retrieval system