KEGG   Geobacillus sp. Y412MC61: GYMC61_2573Help
Entry
GYMC61_2573       CDS       T01101                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GYMC61_2573
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GYMC61_2573
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GYMC61_2573
Enzymes [BR:gyc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GYMC61_2573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2610668..2611885)
Genome map
AA seq 405 aa AA seqDB search
MSFSYVSHLYCPKCERTYDVDQIHQLCECGSPLLVAYDLESMRQKVKRDVLREREANLWR
YHELLPVKHPEHIVSLGEGMTPLVPMMRLGRKIGIEALYMKDEGVIPTGTFKARGAAVGV
SKAKELGVKQLAMPTNGNAGAAWSLYAARAGIQATVVMPVDAPELTRKECAIAGAELYLV
NGLISDAGQIVAKAIREYGWYDASTLKEPYRIEGKKTMGLEIAEQFSWQLPDVILYPTGG
GVGLIGIYKAIKELQALGWVDGRMPRLVAVQAEHCAPIVKAWKEKKRESKFWPNAHTVAF
GINVPKALGDFLVLEAVYETDGCAIAVNDEAILAEQRTAAELEGAFICPEGAAAFAAART
LRESGWIRDGETVVVLNTGTGLKYADTVDVHPPVLEPGDMLPKEN
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcagctacgtgtctcatctgtattgtccgaagtgtgaacgtacatacgatgtc
gaccaaatccatcaactttgcgaatgcggttcgccgcttcttgtcgcttacgacttggag
tcgatgcgccaaaaagtcaagagggatgtgctgagggaacgtgaagcgaatttatggcgt
tatcatgagttgctgccggtaaagcatcctgaacatatcgtgtcgctcggcgaagggatg
acgccgcttgtgccgatgatgcggcttggcagaaagatcggcattgaagcgctctacatg
aaagacgaaggggtcattccaacaggaacgttcaaagcccgcggggcggcggtcggggtt
tccaaagccaaggaactgggcgtcaagcagcttgcgatgccgacaaacggcaacgccggc
gcggcatggtcgctctacgcggcgcgggcgggcattcaggcgacagtcgtcatgccggtt
gatgcaccggaactgacgcgaaaggaatgcgccatcgctggggcggaactgtatttagtc
aacggcctcattagcgatgccgggcaaatcgtcgccaaagcgatccgcgaatacggctgg
tacgatgcgtcgacgttgaaagaaccgtaccggattgaagggaagaaaacgatgggactg
gagatcgccgaacaattctcgtggcagctcccggatgtcattttgtatccgaccggcggc
ggcgtcgggttgatcggcatttacaaggcgatcaaagaattgcaggcgctcggctgggtg
gacggccgcatgccgcggcttgtcgctgtgcaggccgagcattgcgcgccgatcgtcaag
gcgtggaaggagaaaaaacgtgaatcgaagttttggccgaacgcccatacagtggcgttt
ggcatcaatgtgccgaaagcgcttggcgactttcttgttcttgaggcggtgtatgagacg
gacggttgcgctattgccgtcaacgatgaagcgattttggctgaacagcggacggcagcc
gaactcgaaggggcgttcatttgcccggaaggagcggcggcgtttgcggcggcacgaacg
ttgcgcgagagcggttggattcgtgatggggagacggtcgtcgtattaaataccggaacc
gggctgaaatacgccgatacggtggacgtccatccgccggtgctcgagccgggggatatg
cttccaaaggagaattga

DBGET integrated database retrieval system