KEGG   Geobacillus sp. Y412MC61: GYMC61_2633Help
Entry
GYMC61_2633       CDS       T01101                                 

Definition
BAAT/acyl-CoA thioester hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
gyc  Geobacillus sp. Y412MC61
Brite
Enzymes [BR:gyc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     GYMC61_2633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2669421..2670173)
Genome map
AA seq 250 aa AA seqDB search
MSEQYPVLPGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGT
HYEDMERTTFHDWIASVEEGYEWLKKRCQTIFVTGLSMGGTLTLYMAERYPSIRGIVLIN
AAIDIPAIRAGLAGGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMEQVKGE
LERVTCPILIFVSNEDHVVPPENADIIFRGVHSSDKEIVRLKNSYHVATLDHDQPLVIER
SLRFFAKHSK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacaatatccggtgcttccgggcgccgagccgttttacgccgaaaacgggccg
gtcggggtgctgctcgtgcacggattcacgggcacgccccacagcatgcgcccgctcgct
gaggcgtatgcgaaagccggctacacggtctgcctgccgcgcttaaaagggcacggaacg
cattatgaagacatggagcggacgacgttccacgactggatcgcctcggtcgaagaagga
tatgaatggctgaaaaaacgatgccaaaccatttttgtcaccggtctttccatgggtggg
acgctgacgctttatatggcggaacgttacccgtccatccgcggcatcgtccttatcaat
gcggcgattgacatcccggccatccgcgctggtctagcgggtggcggcgagctgccgagg
tatctggattcgatcggttcggacttgaaaaatccggatgtgaaagagctggcatacgag
aaaacgccgaccgcttcgcttcttcagctggctaggctgatggagcaagtgaaaggcgag
ctggaacgtgtgacatgcccgattttaattttcgtctcgaacgaagaccatgtcgtgccg
cctgagaacgcggacatcatttttcgcggcgtccactcgtcagacaaagagatcgttcgg
ctgaaaaacagctatcatgtcgcgacacttgatcatgaccagccgctcgtgattgaacgg
tcgcttcgttttttcgccaagcattcgaaatag

DBGET integrated database retrieval system