KEGG   Geobacillus sp. Y412MC61: GYMC61_2640Help
Entry
GYMC61_2640       CDS       T01101                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GYMC61_2640 (hemD)
Enzymes [BR:gyc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     GYMC61_2640 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2677188..2677982)
Genome map
AA seq 264 aa AA seqDB search
MHGKRIALCASRKLDEMTTLIEKQGGTAIIRPAQGTVFSKGSELGEEMRTVIAMRPDWIV
FTTGIGFEALLEAADREGMAAQWHRTIKEANVAARGYKTVTALKQIGVTPVAVSEDGTTK
GLIAALYGHDFADKNVVVQLYGDTAPALKQFFLEQGALYTELLPYRHIAPDEETLATLYK
EIVGREVDAVCFTSAMQVRFFFSFAREKKEIAPLLDAFRTDVVACAVGKVTKEALEEEGV
DRVIAPEHERMGAMIVTLARYFGA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgcatggcaaacggattgccttgtgcgcgtcacgcaaactggacgaaatgacaacactt
attgaaaagcaaggaggaacggccatcattcgtccggcgcaagggaccgtcttttcaaag
ggaagcgaactgggagaggaaatgcgaaccgtcatcgccatgcggccggactggatcgta
tttacgacgggaatcggcttcgaggcgctgttggaagcggccgaccgggagggaatggct
gcccaatggcatcgaacgatcaaggaagcgaacgtggctgcccgcggctataaaacggtg
acggcgttgaaacaaatcggcgtcactccggtggcagtaagcgaggacgggacgacgaaa
gggttgattgctgctctttatgggcacgactttgcggataagaacgttgttgtgcagctg
tacggcgataccgcgccagccttgaagcagttttttcttgaacaaggcgctttgtatacg
gaattgttgccataccggcatatcgctccggatgaggagacactggcgacattgtataaa
gaaatcgtcgggcgcgaagtcgatgccgtctgttttacttcagcgatgcaagtccgcttt
ttcttttcgttcgcccgcgagaaaaaagagatcgcaccgctgcttgacgcgtttcgcacc
gatgtcgtggcctgcgccgttggcaaagtgacaaaagaagcattggaagaagagggagtc
gatcgcgtcatcgccccggaacatgagcggatgggagcgatgatcgtgacgctcgcacgc
tactttggtgcgtaa

DBGET integrated database retrieval system