KEGG   Geobacillus sp. Y412MC61: GYMC61_2667Help
Entry
GYMC61_2667       CDS       T01101                                 

Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC61_2667
Enzymes [BR:gyc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     GYMC61_2667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2705769..2707181)
Genome map
AA seq 470 aa AA seqDB search
MEQQSKQPTTYRFPTGFWWGSATSATQIEGAANEGGKGKNIWDHWYEQEPHRFFQGVGPE
VTSDFYHRYKEDIALMKEIGHNSFRFSISWSRLIPDGIGDVNPEAVRFYNAVIDELLANG
IEPFVNLYHFDMPLVMQNIGGWENRVVIDAYARYASLCFQLFGDRVKTWFTHNEPIVPVE
GGYLYDFHYPNVVDFRRAVQVAYHTMIAHAKAVAAFRKAAIRGGKIGIILNLTPSYPRSQ
HPADVKAAHIADLLFNRSFLDPAVKGEYPQDLIELLAEHGFLPVTEAGDRELIKENTIDL
LGINYYQPRRVKAKEHLPNPDAPFLPERFFDYYAMPGRKMNPYRGWEIYEKGIYDILINI
KENYRNIESFISENGMGVEGEERFRDESGMIHDDYRIEFIREHLKWVHRAIEEGVNVKGY
HLWTFMDNWSWTNAYKNRYGLVAVDLDNHLKRTIKKSGYWLKTVAENNGF
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggaacaacaatcgaagcaaccaaccacatatcgtttccctaccggattttggtgggga
agtgcgacatccgcgacgcaaatcgaaggagcggcaaatgaaggggggaaagggaaaaac
atttgggatcattggtatgaacaagagcctcaccgcttttttcaaggcgtcggcccagag
gtgacatccgatttttatcatcgctacaaagaagatattgcgttaatgaaggaaattggc
cataactcattccggttttccatttcatggtcgcgcttgattccagatgggattggtgac
gtcaatccggaggcggtgcggttctacaacgctgtcatcgatgaattgttggcgaatggg
attgaaccgtttgtgaatttataccattttgatatgccgttggtgatgcaaaacattggt
ggttgggaaaatcgcgtggttatcgatgcttatgctcgctatgccagcctttgctttcag
ctgtttggcgatcgggtgaaaacatggtttacgcacaatgaacccattgtccctgtagaa
ggcgggtatttgtacgattttcactatccgaatgtggttgacttccgccgtgccgtgcag
gtggcttaccatacgatgattgcccatgccaaagcggttgccgccttccgcaaagcagcg
atacggggcggaaagatcggcattattttgaatttaacgccgtcttatccgcgcagccag
catccagctgatgtgaaagcagcgcatattgcggatttgctgtttaaccgcagtttcttg
gatcctgcggtaaaaggagaatacccgcaagatttaatcgagctgttggctgaacacggt
tttttgccggtgacggaagcgggcgatcgcgaacttatcaaagaaaatacgatcgatttg
cttggcatcaactactatcaaccgcgtcgcgtcaaggcgaaagaacatctgcccaacccg
gacgccccgtttttgccggaacggtttttcgattactatgccatgccggggcggaagatg
aatccgtatcgcgggtgggaaatttatgaaaaaggcatttatgatattttaatcaatatc
aaggaaaactatagaaacattgagagctttatttccgaaaatggcatgggcgttgaagga
gaagaacggttccgtgatgaaagcggcatgattcatgacgactaccggattgaattcatt
cgtgagcatttaaaatgggtgcatcgcgcgattgaagaaggggtcaatgtaaaaggatac
cacctttggacatttatggacaactggtcgtggacgaatgcctacaaaaatcggtacgga
ttggtcgctgttgacctagacaatcatttgaaacggacgatcaaaaagagcggctactgg
ttgaaaacagtggcggaaaacaatgggttttaa

DBGET integrated database retrieval system