KEGG   Geobacillus sp. Y412MC61: GYMC61_2688Help
Entry
GYMC61_2688       CDS       T01101                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GYMC61_2688
   00051 Fructose and mannose metabolism
    GYMC61_2688
Enzymes [BR:gyc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     GYMC61_2688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2727191..2728528)
Genome map
AA seq 445 aa AA seqDB search
MAYFPNIGTIPYEGPESRNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFG
VGNMIRPWDKYSGMDLAKARVEAAFELFEKLNVPFFCFHDVDIAPEGETLSETYKNLDEI
VDMIEEYMKTSKTKLLWNTANLFSHPRFVHGAATSCNADVFAYAAAKVKKGLEIAKRLGA
ENYVFWGGREGYETLLNTDMKLELDNLARFLHMAVDYAKEIGFDGQFLIEPKPKEPTKHQ
YDFDVATALAFLQTYGLKDHFKFNIEANHATLAGHTFEHELRVARIHGMLGSVDANQGDT
LLGWDTDEFPTDLYATTLAMYEILQNGGLGRGGLNFDAKVRRGSFEPEDLFYAHIAGMDS
FAIGLKVAHRLLEDRVFEQFIEERYKSYTEGIGREIVEGTADFKKLEEYALQLGEIRNAS
GRLERLKTLLNQYLLEVSVPSVSRS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatttcccgaatatcggaaccattccatatgaaggaccggagtcgcgcaatccg
ttggcgtttaagttttataatccggaagaaaaagtcggcgacaaaacaatggaggagcat
ttgcgcttttcggtcgcctattggcatacgttcacgggggatggatcggatccgtttggc
gtcggcaatatgattcgtccgtgggacaaatatagcggcatggatctagcaaaggcgcgc
gtcgaggcggcgtttgagctgtttgaaaagctgaacgttccgtttttctgcttccatgac
gtcgacattgcgccagaaggggaaacgctcagcgagacgtacaaaaacttggatgaaatc
gtcgatatgattgaagagtacatgaaaacaagcaaaacgaagctgctgtggaatacggcg
aacttgttcagccatccgcgcttcgttcacggggcggcgacgtcgtgcaatgccgatgtg
ttcgcctatgcggcggcgaaagtgaaaaaagggttggagatcgccaaacggctcggagcg
gaaaactacgtgttctggggcggccgggaaggttatgagacgctgctgaacacggacatg
aagctggaacttgacaatttggctcgcttcttgcacatggcggtcgactatgcgaaagaa
atcggatttgacggccagtttttgatcgagccgaagccgaaagagccgacgaagcaccaa
tatgacttcgatgtggcgacggcgttggcgttcttgcagacatatgggctgaaagatcat
ttcaaattcaatattgaagcgaaccatgcgacattggccgggcatacgtttgagcacgag
ctgcgcgtcgcccgcattcatggcatgttgggctcggtcgatgcgaaccaaggcgatacg
ctgctcggctgggatacggacgagttcccgacagatttgtatgcgacgacgctggcgatg
tatgaaattttgcaaaacggcggccttgggcgcggcggcttgaactttgacgcgaaagtg
cggagaggctcgtttgaaccggaggacttgttctacgctcatatcgccgggatggacagc
tttgcgatcggtttgaaagtcgcccatcgcttgttggaagaccgcgtgtttgaacagttc
atcgaagaacggtacaaaagctatacagaaggcatcggccgcgagatcgtcgaagggacg
gcggacttcaaaaagcttgaggagtacgccttgcagctcggcgaaattcgcaatgcgtcc
ggccgtctcgaacgcttgaaaacgctgctcaaccaatatttgttggaagtcagcgtgccg
agcgtatcccgttcgtga

DBGET integrated database retrieval system