KEGG   Geobacillus sp. Y412MC61: GYMC61_2757Help
Entry
GYMC61_2757       CDS       T01101                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GYMC61_2757
Enzymes [BR:gyc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     GYMC61_2757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2813356..2814330
Genome map
AA seq 324 aa AA seqDB search
MYKPKDSSQSPRFCGVRTFMRLEPIKTTDNVDFVVLGVPFDTAASNRTGQRYGPQHIRNF
SVLLRPYNPDMDIDIFAYCSGVDYGDVDVIPGNALRTYDRIVEELRPLLKKNIVPILMGG
DHSITLGHLRAFCERFGPVALVHFDSHSDTWDHYYGEKYMHGTPFRRAVEEGLLDVNHSI
QVGMRGPLYSADDLEDARRLGFEVIPMKEVRQIGFSEVMRRIHQRVGNRPVFVSYDIDFV
DPAFAPGTGTPEVGGPTSYEALEYVRGLDGLNIVGFDLVEVLPAYDSGEMTAVLASAIIY
EMITLVALKKRRAQANRLSTATTP
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaccgaaagattcttcccaatcgccccgcttttgcggcgttcgaacctttatg
cggttagaaccaatcaaaacgacagataacgttgattttgtcgtgctcggcgtcccgttt
gatacggcagcctcgaatcggacgggacaacggtatggtccgcaacacattcgcaatttt
tccgtcctgttgcgcccttacaaccccgacatggatatcgatatttttgcctattgttct
ggcgtcgattacggggacgttgatgtcatcccgggcaatgcgctccgcacatatgatcgc
atcgtcgaagagctgcggccattgttaaagaaaaacatcgttccgattctgatgggcggc
gaccattccattacattggggcacttgcgggctttttgcgaacgctttggtcccgtcgcc
ctcgttcattttgactcacacagcgacacatgggaccattactatggagaaaaatatatg
catggcacgccgttccgccgcgcggtcgaggaagggctgctcgatgtcaatcattccatt
caagtcggaatgcgcggaccgctttacagcgcggatgatctcgaggacgcacgacggctt
ggctttgaagtcattccgatgaaagaagtccggcaaatcggcttttcggaagtcatgcgc
cgcatccatcaacgtgtcggaaacagaccggttttcgtttcttatgacattgactttgtt
gatccggcattcgctcctggaacaggcacgccggaagtaggcggaccgacaagctatgag
gcattagaatacgtaagagggcttgacgggttaaatattgtcgggtttgatctcgtcgag
gtattgcctgcttatgacagcggggaaatgacagccgtattggcgtctgccattatatat
gaaatgatcacgcttgtggcgctaaagaaaaggcgggcgcaggctaaccgtctatccacg
gcgacaacgccataa

DBGET integrated database retrieval system