KEGG   Geobacillus sp. Y412MC61: GYMC61_3126Help
Entry
GYMC61_3126       CDS       T01101                                 

Definition
(GenBank) carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
gyc  Geobacillus sp. Y412MC61
Brite
Enzymes [BR:gyc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     GYMC61_3126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Peptidase_S9 Abhydrolase_6 DUF2048 BAAT_C DLH PhoPQ_related UPF0227 DUF676 DUF677 AlkA_N TMP_2 DUF1216
Motif
Other DBs
NCBI-ProteinID: ACX79684
JGI: GYMC61_3126
Position
complement(3176528..3177271)
Genome map
AA seq 247 aa AA seqDB search
MMKIVPPKPFFFEAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPIYKGHGVPPEE
LVHTGPDDWWQDVMNGYQFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPIEGIVTMCAPMY
IKSEETMYEGVLEYAREYKKREGKSEEQIEQEMERFKQTPMKTLKALQELIADVRAHLDL
VYAPTFVVQARHDEMINPDSANIIYNEIESPVKQIKWYEQSGHVITLDQEKDQLHEDIYA
FLESLDW
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaattgttccgccgaagccgtttttctttgaagccggggagcgggcggtgttg
cttttgcatgggtttaccggcaattccgccgacgttcggatgcttgggcgattcttggaa
tcgaaagggtatacgtgccacgctccgatttacaaagggcatggcgtgccgccggaagag
ctcgtccacaccggaccggatgattggtggcaagacgtcatgaacggctatcagtttttg
aaaaacaaaggctacgaaaaaattgccgtggctggattgtctcttggaggcgtattttct
ctcaaattaggctacactgtacctatagaaggcattgtgacgatgtgcgcgccgatgtac
atcaaaagcgaagaaacgatgtacgaaggtgtgctcgagtatgcgcgcgagtataaaaag
cgggaagggaaatcagaggaacaaatcgaacaggaaatggaacggttcaaacaaacgccg
atgaagacgttgaaagccttgcaagaactcattgccgatgtgcgcgcccaccttgatttg
gtttatgcaccgacgttcgtcgtccaagcgcgccatgatgagatgatcaatccagacagc
gcgaacatcatttataacgaaattgaatcgccggtcaaacaaatcaaatggtatgagcaa
tcaggccatgtgattacgcttgatcaagaaaaagatcagctgcatgaagatatttatgca
tttcttgaatcgttagattggtaa

DBGET integrated database retrieval system