KEGG   Geobacillus sp. Y412MC61: GYMC61_3320Help
Entry
GYMC61_3320       CDS       T01101                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
gyc00010  Glycolysis / Gluconeogenesis
gyc00020  Citrate cycle (TCA cycle)
gyc00620  Pyruvate metabolism
gyc01100  Metabolic pathways
gyc01110  Biosynthesis of secondary metabolites
gyc01120  Microbial metabolism in diverse environments
gyc01130  Biosynthesis of antibiotics
gyc01200  Carbon metabolism
Module
gyc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC61_3320
   00020 Citrate cycle (TCA cycle)
    GYMC61_3320
   00620 Pyruvate metabolism
    GYMC61_3320
Enzymes [BR:gyc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GYMC61_3320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N CDC48_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ACX79870
JGI: GYMC61_3320
Position
complement(3382663..3383976)
Genome map
AA seq 437 aa AA seqDB search
MIYEFKLPDIGEGLHEAEIIRWLVREGDIVKADQPIAEIQTDKAMVEMTTPVAGKVVALA
GPEGATVKVGESLIVVETEASVAAEAASADDSVREVAPAVHIEAPRPAAVRKRAIAAPSV
RKRAREMGVPIDEVEGTGEGGRVTLADLERYVREREAAASVSEVARREANEAGVLPTGSA
SAARGRQESIAAWTSIASLDAVFEEEERIPLRGLRKKIAEKMVKSMYTAPHVTGMDEVDV
TKLVEIRKHLANQLAEERIKLTYLPFIIKAVTRALKQYPMFNASLDEETNEIVLKKRYHI
GIATATKAGLVVPVIRDADQKSIRELAIEIAELSEKAHRQTLRLEELQGSTFTITSTGAG
GGWFATPIINYPEVAIFGAHAIKRRPVVVGDEIVIRDMMGMSLTFDHRVIDGEPAGRFMR
TVAYYLENPEVLLLDVR
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgatctacgaatttaaattgcccgacattggcgaagggctgcatgaagcggaaatcatt
cgctggcttgtccgagaaggggatatagtcaaagccgatcagccgattgccgaaattcaa
acggataaggcgatggtcgaaatgacgacgccggtggcggggaaagtggtggcgcttgcc
gggccggaaggggcgacggtgaaggttggagagtcgttgattgtcgtggaaaccgaggcg
tcggtggcggccgaagcagcgtcagccgacgattcggttcgggaggttgcgcctgctgtt
catatagaagccccgcgtccagcggcggtgcgcaagcgggcgattgccgcgccgtctgtg
cgcaagcgggcgcgggaaatgggcgttccgatcgatgaagtggaaggaacgggcgaaggc
ggccgggtgacgctcgccgacttggagcggtatgtcagagaacgggaagcagccgcttcg
gtgtcggaggtggcaagaagggaagcgaacgaagccggcgttctgccgaccggcagcgcg
agtgcggccagaggacggcaggagagtatagccgcatggacgtccatcgcgagtctggat
gcggtgtttgaagaagaagagcgaatcccgcttcgaggcttgcgcaaaaaaatcgccgaa
aaaatggtgaaatcgatgtacacggcgccgcatgtgaccggcatggacgaggtggacgtc
acgaagttggtggaaatccgcaagcaccttgccaatcaattggcggaagaacgcatcaaa
ctgacgtatttgccgtttattattaaagcggtgacaagggcgctgaagcaatatccgatg
tttaacgcttcgctcgatgaagagacgaatgaaatcgtcttgaaaaagcgctatcacatc
ggcatcgcgacggcgacgaaagccggtctcgtcgttcccgtcatccgtgacgccgatcaa
aaatcgatccgcgagctcgccatcgaaatcgcggaactgtcagaaaaagcgcaccgacag
acgcttcgccttgaggagctgcaaggaagcacgtttacgatcacgagcaccggggcgggc
gggggctggtttgcgacgccgatcatcaactatccggaagtggcgattttcggcgcgcat
gcgatcaaacggcgcccggttgtcgtcggcgacgaaattgtcatccgcgatatgatgggg
atgtcgctcacctttgatcaccgcgtcattgacggcgagccggccgggcggtttatgcgg
acggtggcctactatttggaaaatccggaagtgctgctcttggacgtgcggtag

DBGET integrated database retrieval system