KEGG   Geobacillus sp. Y412MC61: GYMC61_3332Help
Entry
GYMC61_3332       CDS       T01101                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GYMC61_3332
Enzymes [BR:gyc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     GYMC61_3332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3394135..3395028)
Genome map
AA seq 297 aa AA seqDB search
MNKPTITVIGSINMDLVTVAVRFPNQGETILGEQFLTTPGGKGANQAVAAARLGADVRMI
GAVGDDAFGQELIRSLQNEGVSVDYVKPVTYEHTGIASITISERDNRIIVVPGANHALTP
EDLDPYESVIAESDVCLLQLEIPLPVVERAVSIAHRHGVRVIVNPAPAQPLPLVVLEQAS
FLTPNEHERAILFDKMDEEAFADKLIVTEGAKGVRIWQDGQERLIPSFHVPVVDTTGAGD
TFNGALAVALAEGKPLDEACRFANAAAALSVTKLGAQAGMPRRQEVESFLSRQKESH
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaaaccaaccattacggtgatcggcagcatcaacatggacttagtcactgtggcg
gtgcgctttcccaatcaaggagagacgattttaggcgaacagtttctcaccactcctggc
ggcaaaggggcgaaccaggcggtggccgccgcccgcctcggcgccgatgtacggatgatt
ggcgcggtgggggatgatgcgtttggtcaagagctcatccgttcgttacaaaatgaaggc
gtttccgtcgattatgtgaaaccggttacatatgaacatacaggcatcgcttccattacg
atttctgagcgggacaatcgcattattgtcgtccccggggcgaatcatgcgcttacgccg
gaggatctggatccatatgaatccgtgatcgccgaaagcgatgtgtgcttactgcagctc
gagattccgcttcccgttgtggaacgagcggtttcgatcgctcatcgccatggcgtgcgc
gtcatcgtgaacccagctccagcccagccgctgccgctcgtggtgcttgagcaggcgagt
ttcttgacgccgaatgaacatgaacgggccattttgtttgacaagatggacgaagaagcg
tttgccgataagctgattgtcaccgaaggggcaaaaggggtgcgcatttggcaagatgga
caagaacggctcattccaagttttcacgttcccgtcgtggatacgacgggcgcgggcgat
acgtttaacggtgcgcttgccgtggcgctggcggaagggaagccgcttgatgaagcgtgt
cggtttgccaatgcggcggcggccttgtcggtgacgaaacttggggcgcaagctgggatg
ccgagacggcaagaggtcgaatcatttttgtccagacagaaggagagtcactga

DBGET integrated database retrieval system