KEGG   Geobacillus sp. Y412MC61: GYMC61_3361Help
Entry
GYMC61_3361       CDS       T01101                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GYMC61_3361
   00052 Galactose metabolism
    GYMC61_3361
   00500 Starch and sucrose metabolism
    GYMC61_3361
   00520 Amino sugar and nucleotide sugar metabolism
    GYMC61_3361
Enzymes [BR:gyc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GYMC61_3361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3424470..3425357)
Genome map
AA seq 295 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIASGIEDIIIVTGKG
KRAIEDHFDYAFELEQMLKQKGKLDLLEKVKEPSKVDIHYIRQKEPKGLGHAVWCARNFI
GDEPFAVLLGDDIVQAEKPCLKQLIEQYEQTFSSVIGVKRVPEEETHRYGIIDPLEQQGR
RYQVRRFVEKPAPGTAPSNLAIVGRYVLTPEIFLFLEKQEAGAGGEIQLTDAIGRLNEIQ
RVFAYEFEGKRYDVGEKLGFIETTIEFALQNEELRDDLLSFLERVVAEAKGSKSS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtacgcaaagcgatcattccggcggccgggcttgggacgcggtttttgccg
gcgacgaaggcaatgccgaaggagatgcttccgatcgttgataagccgacgattcaatat
attgtcgaagaagccatcgcctcaggcattgaggacatcatcatcgtcaccgggaaaggg
aagcgggcgattgaggatcattttgactacgcgtttgagctggaacagatgctcaagcaa
aaagggaagctggatctgcttgagaaagtgaaagagccgtcgaaggttgacatccactac
attcgccaaaaagagccgaaagggctggggcatgcggtttggtgcgcgcgcaatttcatt
ggagacgagccgtttgcggtgttgttgggcgatgatatcgtccaggcggaaaagccttgt
ttaaaacagctcattgagcagtatgaacaaacgttcagctcggtgatcggcgtcaagcgc
gtgccggaggaagaaacgcatcgctacgggatcatcgacccgctcgagcagcaaggccgg
cgctaccaagtgcgccgcttcgtggaaaaaccagctccgggcacagcgccgtcgaacttg
gcgatcgtcggccgctacgtgttgacgccggaaattttcttgtttttagagaaacaggaa
gccggcgcaggcggggagattcagctcaccgatgcaatcgggcggttgaatgaaattcag
cgcgtgtttgcctatgaatttgaaggaaagcggtacgatgtcggcgaaaagctcggcttt
atcgaaacgacgattgagtttgccctgcaaaacgaggagctgcgggatgacttgctttcg
tttttggagcgggtggtggcagaggcgaagggatcgaagagcagctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system