KEGG   Geobacillus sp. Y412MC61: GYMC61_3361Help
Entry
GYMC61_3361       CDS       T01101                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
gyc00040  Pentose and glucuronate interconversions
gyc00052  Galactose metabolism
gyc00500  Starch and sucrose metabolism
gyc00520  Amino sugar and nucleotide sugar metabolism
gyc01100  Metabolic pathways
gyc01130  Biosynthesis of antibiotics
Module
gyc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GYMC61_3361
   00052 Galactose metabolism
    GYMC61_3361
   00500 Starch and sucrose metabolism
    GYMC61_3361
   00520 Amino sugar and nucleotide sugar metabolism
    GYMC61_3361
Enzymes [BR:gyc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GYMC61_3361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3 Smr
Motif
Other DBs
NCBI-ProteinID: ACX79910
JGI: GYMC61_3361
Position
complement(3424470..3425357)
Genome map
AA seq 295 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIASGIEDIIIVTGKG
KRAIEDHFDYAFELEQMLKQKGKLDLLEKVKEPSKVDIHYIRQKEPKGLGHAVWCARNFI
GDEPFAVLLGDDIVQAEKPCLKQLIEQYEQTFSSVIGVKRVPEEETHRYGIIDPLEQQGR
RYQVRRFVEKPAPGTAPSNLAIVGRYVLTPEIFLFLEKQEAGAGGEIQLTDAIGRLNEIQ
RVFAYEFEGKRYDVGEKLGFIETTIEFALQNEELRDDLLSFLERVVAEAKGSKSS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtacgcaaagcgatcattccggcggccgggcttgggacgcggtttttgccg
gcgacgaaggcaatgccgaaggagatgcttccgatcgttgataagccgacgattcaatat
attgtcgaagaagccatcgcctcaggcattgaggacatcatcatcgtcaccgggaaaggg
aagcgggcgattgaggatcattttgactacgcgtttgagctggaacagatgctcaagcaa
aaagggaagctggatctgcttgagaaagtgaaagagccgtcgaaggttgacatccactac
attcgccaaaaagagccgaaagggctggggcatgcggtttggtgcgcgcgcaatttcatt
ggagacgagccgtttgcggtgttgttgggcgatgatatcgtccaggcggaaaagccttgt
ttaaaacagctcattgagcagtatgaacaaacgttcagctcggtgatcggcgtcaagcgc
gtgccggaggaagaaacgcatcgctacgggatcatcgacccgctcgagcagcaaggccgg
cgctaccaagtgcgccgcttcgtggaaaaaccagctccgggcacagcgccgtcgaacttg
gcgatcgtcggccgctacgtgttgacgccggaaattttcttgtttttagagaaacaggaa
gccggcgcaggcggggagattcagctcaccgatgcaatcgggcggttgaatgaaattcag
cgcgtgtttgcctatgaatttgaaggaaagcggtacgatgtcggcgaaaagctcggcttt
atcgaaacgacgattgagtttgccctgcaaaacgaggagctgcgggatgacttgctttcg
tttttggagcgggtggtggcagaggcgaagggatcgaagagcagctaa

DBGET integrated database retrieval system