KEGG   Geobacillus sp. Y412MC61: GYMC61_3460Help
Entry
GYMC61_3460       CDS       T01101                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
gyc00330  Arginine and proline metabolism
gyc01100  Metabolic pathways
Module
gyc_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GYMC61_3460
Enzymes [BR:gyc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     GYMC61_3460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACX80008
JGI: GYMC61_3460
Position
complement(3521842..3522717)
Genome map
AA seq 291 aa AA seqDB search
MRFDEAYSGNVFIGSHPNFEESEAVIYGMPMDWTVSYRPGSRFGPARIREVSIGLEEYSP
YLDRELKDIRYFDAGDIPLPFGNAARSLELIEQFVKKVLDAGKFPLGLGGEHLVSWPVMK
AVYEYYPDLAVIHMDAHTDLREHYEGEPLSHATPIRKVADLIGPTNVFSFGIRSGMKEEF
EWAKENGMYIAKFEVLEPLRSVLPKLAGRPVYVTIDIDVLDPAHAPGTGTVDAGGITSKE
LLSAIHEIARSNVRVVGADLVEVAPIYDHSEQTANTASKLVREMLLGWVAK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcgatttgatgaagcctattcgggcaacgtgtttatcggcagccatccgaattttgaa
gaaagcgaagccgtcatttacgggatgccgatggactggacggtcagctaccggcctggc
tcgcggtttggcccggcccgcatccgcgaagtgtcaatcgggcttgaggagtacagccca
tatttggaccgcgaactcaaagacatccgctactttgacgctggggacattccgctgcca
tttggcaatgcggcccgcagtttggagctgattgaacagttcgtgaaaaaggtgcttgac
gccggcaaatttccgctcggccttggcggagagcatcttgtctcctggccggtcatgaaa
gcggtgtatgaatactacccggatttggccgtcattcatatggatgcgcacacggacttg
cgcgaacattacgaaggcgagccgctgtcgcacgcgacgccaatccgcaaggtcgctgac
ctgatcggcccgacgaatgtcttttcgttcggcatccgatccggcatgaaggaagagttc
gaatgggcgaaagaaaacggcatgtacatcgccaagtttgaggtgcttgaaccgctccgc
tccgtgttgccgaagctcgctggccgtccggtgtatgtgacgattgacatcgatgtgctt
gatcctgctcatgccccaggcactgggacggtcgatgccggcggcattacgtcaaaagag
ctgctttcggccattcacgagatcgcccgctccaacgtgcgagtcgttggcgccgatttg
gtggaagtcgcaccgatttacgaccattccgaacaaacggccaatacggcgagcaagctt
gtgagagaaatgctgcttggctgggtggcgaagtga

DBGET integrated database retrieval system