KEGG   Paenibacillus sp. Y412MC10: GYMC10_0066Help
Entry
GYMC10_0066       CDS       T01100                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gym00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
73886..74746
Genome map
AA seq 286 aa AA seqDB search
MKTTIYEREYRLGKDAELKLGQSTLIMGILNVTPDSFSDGGRYNDTERAVEHALQLIEEG
ADIIDIGGESTRPGHEPVGASEELARVIPVIEAIHRHAPQIPLSIDTYKAEVARQAIGAG
AHIINDIWGFKDDPDMPKTAAELGCPVILMHNRRERNYTNLIEDVKRDLLESVEIARTAG
VQDHQILLDPGIGFAKDYDENMKVMASLDQLVGLGFPVLLATSRKRFIQTALGAPAQDVL
EGTAATVAYGIAQGCQIVRVHDVKHMKRTAKMCDAMTYASTELQRN
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaccatctatgaacgtgaatatcgtttgggcaaggacgctgagttaaagctc
ggtcaatcgacgcttattatgggcatattgaatgtgacgccggattcgttctcggacgga
ggccgttataacgacacggagcgagcggtggagcatgcgcttcagctgattgaggaggga
gccgacatcatcgatatcggcggggaatcgacgcggccgggacacgagccggttggagct
tcagaggagcttgcccgcgtaatcccggttattgaagctattcaccggcacgcgccgcaa
attccgttgtcgattgacacctataaagcggaagtggcgcgccaggcaattggagcgggg
gctcatatcattaatgatatctggggctttaaagacgatcctgatatgcctaagacggcg
gcagagctcggatgcccggtcattcttatgcataatcgacgcgaacgaaattacacgaat
ctgatagaagacgtaaaacgcgatttgctggaaagcgtcgaaattgcgcgcactgccggt
gtgcaggatcaccaaatattgcttgatccgggcatcgggtttgcaaaggactatgacgag
aacatgaaagtgatggcatcactcgatcagcttgtgggattggggtttccggtactgctg
gctacctcccgcaaaaggtttatccaaaccgcgcttggcgctccggcacaagacgtgctg
gaaggaacggcagccaccgtcgcatacgggattgcgcaaggctgtcagatcgttcgggtg
cacgacgtgaagcatatgaaacggacagccaagatgtgcgatgccatgacttacgcttca
acggagcttcaacgcaactaa

DBGET integrated database retrieval system