KEGG   Paenibacillus sp. Y412MC10: GYMC10_0068Help
Entry
GYMC10_0068       CDS       T01100                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gym00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
75153..75701
Genome map
AA seq 182 aa AA seqDB search
MNSHATSECSEAYIALGANLGDREGNLMEALERLDEVPGIEVDRVSNLYETEPVGYVDQP
MFLNMAAAVSTSLSPHELLAVMQQIEKQLGRVRHIHWGPRTVDLDLLWMEGRRLDTPDLV
LPHPRMQERAFVLRPLADIVSELEPSGLYPVVKTALENLEGKEGIQLWKTSSWRSVSALS
EN
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaattcacacgccacctctgagtgttcagaggcttatattgctttaggggccaatttg
ggagaccgcgaggggaacctgatggaggctttggaacggttggatgaagtgccaggcatt
gaggtagaccgcgtatccaacctgtatgagaccgaaccggtcggttacgtggatcagccg
atgttccttaatatggccgcagccgtgtcgacatcgctgagtccccatgagctgcttgcc
gtaatgcagcaaatcgagaaacagctcggccgggtccgtcatattcactggggaccgcgg
acggtggatctggatctgttatggatggaaggacgccgtctggatacgccggacctcgtt
ctgccgcatccccgcatgcaggaacgggctttcgttctcaggccgctggccgatatcgtg
tctgagcttgaaccttctggtctgtaccccgtggtgaagacagcacttgagaacctggaa
ggaaaggaaggaattcagctttggaaaacaagcagctggcgcagcgtatccgcgctttcc
gaaaattga

DBGET integrated database retrieval system