KEGG   Paenibacillus sp. Y412MC10: GYMC10_0134Help
Entry
GYMC10_0134       CDS       T01100                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gym00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GYMC10_0134
DNA repair and recombination proteins [BR:gym03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      GYMC10_0134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
156070..156669
Genome map
AA seq 199 aa AA seqDB search
MYYPEPIAKLIDAFTRLPGVGPKTAARLAFHVLNMKEDDVIDFAKALVSVKRNLHYCSVC
CNITDTDPCRVCQDKTRDASIICVVQDAKDLVAMERTKEFEGYYHVLHGAISPMEGIGPD
EIRLKELLTRLSDERVKELILATNANIEGEATAMYISRLVRPFDIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRRELN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgtactatcctgaaccgatcgcgaagctcatcgatgcctttacgcgactgccgggtgtg
gggccgaaaacggccgcccgcctggcttttcatgttctgaacatgaaggaagatgacgtt
attgattttgccaaagcgctagtcagtgtcaaaaggaatctgcactactgctccgtctgc
tgcaacatcacggatacggatccatgccgggtatgtcaggacaagactcgggatgcttcg
atcatctgcgttgtacaggatgcgaaggatctggtggcgatggagcgcacgaaggaattc
gagggctactatcatgtcctccatggggccatatctccgatggaggggatcgggccggat
gaaatccgtctgaaggagctcctcacgcgcttaagtgacgaacgagtgaaagaactcatt
ttggcgacgaacgctaatatcgagggggaggcaacggcgatgtacatatcgcgcctggtc
cgtccctttgatattaaggtgactcgtattgcccatggactgccggttggcggtgacctg
gagtacgcagatgaagtgactttatccaaagcgcttgaaggtcgaagagaactgaactga

DBGET integrated database retrieval system