KEGG   Paenibacillus sp. Y412MC10: GYMC10_0179Help
Entry
GYMC10_0179       CDS       T01100                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym00010  Glycolysis / Gluconeogenesis
gym00052  Galactose metabolism
gym00500  Starch and sucrose metabolism
gym00520  Amino sugar and nucleotide sugar metabolism
gym00521  Streptomycin biosynthesis
gym01100  Metabolic pathways
gym01110  Biosynthesis of secondary metabolites
gym01120  Microbial metabolism in diverse environments
gym01130  Biosynthesis of antibiotics
gym01200  Carbon metabolism
Module
gym_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gym_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC10_0179
   00052 Galactose metabolism
    GYMC10_0179
   00500 Starch and sucrose metabolism
    GYMC10_0179
   00520 Amino sugar and nucleotide sugar metabolism
    GYMC10_0179
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GYMC10_0179
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GYMC10_0179
Enzymes [BR:gym01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GYMC10_0179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Kelch_5
Motif
Other DBs
NCBI-ProteinID: ACX62487
JGI: GYMC10_0179
UniProt: D3E8B5
Position
199960..200910
Genome map
AA seq 316 aa AA seqDB search
MSENIYVGVDLGGTAIKVGICNEEGHLLQKYEGPTETAKGVDTVIDNIEKYVRHIVEESP
YSWDQLAGVGAGFAGFTNIREGIIILAPNVGFKDVPIRALLEERLGKPVKIDNDANVAAL
GEAWSGAGRGVENCVCYTLGTGVGGGIIVNGKIYQGFGGMAGELGHISVVPDLEAIQCGC
GEMGCLETVSSATGIIRMAKDAVERGDRTSLAHVESIAAKEVFDAAKAGDEVAIRIVNRA
AYYLGKSMAAVAAVLNPEAFIIGGGVSKAGDILFNEVRAVFAKLTPEPLQRGVRIVPAEL
GNDAGVVGAAGLHLRS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaacatctacgtcggtgtcgatcttggcggaacagctattaaagttggaata
tgtaacgaagaagggcatcttctgcagaagtacgaagggccgacggaaacagccaaaggc
gttgacacggttattgacaacattgagaaatatgtgcgtcacattgtggaagaatcgcca
tacagctgggatcaacttgctggtgtgggagctggtttcgccgggtttaccaatatacgt
gaaggcatcatcattctggcaccgaatgtaggatttaaagatgtaccgattcgcgcactg
cttgaagagcgtctcggcaagcccgtcaaaatagacaacgacgccaatgtggctgccctg
ggtgaggcttggagcggcgcaggacgcggcgttgagaactgcgtatgctacacgctggga
accggcgtgggcggcggcattattgtaaacggcaaaatttatcaaggcttcggcggcatg
gccggcgagcttgggcatatctcggtcgtgcctgatctggaagccattcaatgcggatgc
ggcgaaatgggctgcctggagacggtttcatcggcaaccggcattatccgcatggcgaag
gatgccgttgagcgcggcgaccgcacttcccttgcgcatgtggagagcattgcggcgaag
gaagtgtttgatgctgcgaaagcgggcgatgaagtcgccattcgcatcgtgaatcgcgca
gcttattacctcggcaaatccatggcagccgttgcggccgtgttaaatcccgaagcgttt
atcatcggcggcggcgtatccaaagccggggacattctgtttaatgaagttcgtgccgta
tttgctaaactgacaccggaaccgcttcaacgcggcgtacggatcgttccagctgagctt
ggcaacgacgccggcgttgttggcgcagccggtttgcacttgcgttcgtag

DBGET integrated database retrieval system