KEGG   Paenibacillus sp. Y412MC10: GYMC10_0200Help
Entry
GYMC10_0200       CDS       T01100                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYMC10_0200
   01230 Biosynthesis of amino acids
    GYMC10_0200
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC10_0200
   00051 Fructose and mannose metabolism
    GYMC10_0200
   00562 Inositol phosphate metabolism
    GYMC10_0200
Enzymes [BR:gym01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GYMC10_0200
Exosome [BR:gym04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GYMC10_0200
  Exosomal proteins of bladder cancer cells
   GYMC10_0200
  Exosomal proteins of melanoma cells
   GYMC10_0200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
223573..224325
Genome map
AA seq 250 aa AA seqDB search
MRTPIIAGNWKMFKTVPEATSFIEDVKGKAEVEGVESVICAPFTNLPALVEAAKGTNIKI
GAQNLHFEDNGAFTGEISGLMLKDLGVDYVIIGHSERRQYFAETDEIVNKKVHAAFRHGL
LPIVCVGEKLEEREAGQTKDVCKVQTEAAFAGVPADQAVHVVIAYEPIWAIGTGKSSTAE
DANEVIAYIRELVKGLYGETVADQVRIQYGGSVKPENVAEYMGQSDIDGALVGGASLQPA
SYIALVEGAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgagaacacctatcatagctggtaactggaaaatgttcaaaactgttccggaagcaact
tcatttattgaagatgtgaaaggcaaagcggaagtagaaggcgtggaaagcgtgatctgc
gcgccgtttaccaatcttcctgcattggttgaagcggcaaagggcacgaacatcaaaatc
ggtgcacaaaatcttcatttcgaagacaatggcgcctttacgggtgaaatcagcggcttg
atgctgaaagacctgggcgtggactacgtcattattggacattccgagcgccgtcagtat
tttgctgaaaccgatgagatcgtgaacaagaaggtacatgcggcattccgtcatggtctt
cttccgatcgtatgcgttggcgagaagctggaagaacgcgaagccggccaaaccaaagac
gtgtgcaaagtacaaacggaagcagcgttcgcaggtgttcctgctgatcaagcggttcat
gtcgttattgcttacgagccaatctgggcaatcggaacgggcaaatcctccacggcagag
gatgcgaatgaagtcatcgcctatattcgcgaactcgttaaaggcctgtacggcgaaacc
gttgcagaccaagtccgcattcaatacggcggcagcgtgaagcctgaaaatgtagcggag
tatatgggacaaagcgacatcgacggcgcgctcgttggtggtgcaagtctacaaccggct
tcctacatcgcactcgttgagggggcgaagtaa

DBGET integrated database retrieval system