KEGG   Paenibacillus sp. Y412MC10: GYMC10_0229Help
Entry
GYMC10_0229       CDS       T01100                                 

Definition
glucan endo-1,6-beta-glucosidase (EC:3.2.1.75)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    GYMC10_0229
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    GYMC10_0229
Enzymes [BR:gym01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     GYMC10_0229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
265395..266741
Genome map
AA seq 448 aa AA seqDB search
MLNITIYQSNGEEELFVKKDKAQLTPVTTGAAKHKVVIDEEQTFQEMDGFGASFTDSAAY
LIHQVLETKQRSELMTQLFDPNEGIGLSVLRQPMGASDYARDFYSYNDMPEGQTDVELEQ
FSIAHDEEDIIPLLQEAVRLNPDVKLMGSPWSPPGWMKTSGSMIGGELKPEYYSVYADYF
VRYIQGYEANGLPIYAVTPQNEALYSPGHYPGMIMLPEAQSDFIKNHLKPQFVKNGIGTK
ILCYDHNWDKPDYPLTVFEQAADAVDGVAWHWYGGKPSAQSEVFEAFPGKEVHFTEGSGG
EWIPPFEQAFSNVMRTGIEILRNHSKSYVLWNMALDEKSGPTVPGFGKSTCRGIVTVNQQ
TKELTYTLDYYALAHFSKVIRPKARRVASTSHEFIRSVAFKNTDGSIAAVLFNDSEAPES
VAIQLRGEEALQLEMPAKSALTVKIESN
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacatcaccatctaccagtcaaacggtgaagaagaattattcgtgaagaaagac
aaggcgcagctaacgcccgtaactacgggtgcagcgaagcataaggttgtcatcgatgag
gagcagacgtttcaggagatggacggcttcggcgcgtccttcacggactccgctgcttat
ttgatccatcaggtgctggagacgaagcagcgttccgagctcatgacgcagctgttcgat
ccaaacgaagggatcgggttatctgtactccgccagccgatgggagcatcggattacgcg
cgtgatttctacagctacaatgatatgcctgagggccagacggatgtagagctggagcag
ttctccattgcgcatgacgaggaagatatcattcctcttctgcaggaagcggtgagattg
aatccggacgtgaagctgatgggttccccgtggagcccgcccggctggatgaagacgagc
gggtcgatgatcggcggagagctgaagccggaatactattcggtgtatgctgattatttt
gtgcgttatatccaagggtatgaagccaacgggctgccgatttatgccgtcacgccgcag
aacgaggcattatactcgccgggacattaccccggcatgatcatgctgcccgaagcgcag
agcgattttatcaagaaccatctgaagccgcaattcgtaaagaacggcatcggtacgaaa
atactctgttatgaccataactgggacaagccggactacccgctgaccgtatttgagcaa
gcggccgacgctgtggatggggttgcctggcactggtacggcggcaaaccgtcggcccaa
tcggaagtcttcgaggcattcccggggaaagaggttcattttacggaaggatcgggcggg
gagtggattccgccgtttgagcaagccttctccaatgtgatgcggaccggaatcgagatt
ctccgcaatcacagtaaatcttacgtgctgtggaatatggcactggacgagaagagcgga
cctaccgtgccgggctttggaaaaagcacctgccgcggcatcgtgacggtgaatcagcag
acgaaggagcttacctatacgctggattactacgcgctggcgcactttagcaaggtgatc
cgtcccaaagcgcggcgtgtggcatctaccagccatgagttcatccgttcggtagccttc
aagaacacggacggctcgattgccgccgtgttgttcaacgacagcgaggctccggagagc
gtggcgatccagctgcgcggggaagaggcgttgcagctggaaatgccggccaagagtgcg
ctgacagtcaagatagagagcaactga

DBGET integrated database retrieval system