KEGG   Paenibacillus sp. Y412MC10: GYMC10_0703Help
Entry
GYMC10_0703       CDS       T01100                                 

Definition
amine oxidase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:gym00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gym00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:gym00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:gym00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:gym00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:gym00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
829489..831093
Genome map
AA seq 534 aa AA seqDB search
MATKEQPKEMTRRQFLTTVGKVGGSVAVFSLMGTMGLLTPETLKAAEYTPPGKNDLHLSG
RGGKKIVILGAGIAGLTAAYELGLAGYDCTILEAKSFAGGRNWTIRKGTSVSEIGSGRQT
SRFDNGLYFNAGPMRIPQFHVTLDYCKKFGVAIEPFNNVNESGYYYNENVGALSGQRVPK
RAAKADVRGYVAEMLAKAVNQNALDLPLTAEEKLKLVDYLKAEGDLNPDLFYKGSERGGY
KDEPGSRLDAGVLRDPFDLKAIINSGFGKYFSNEYGYDQQMMMFHPIGGMDAIVKAFEKR
VGSRIKYRAEVKEIRQSSSGVRIVYADGHSGRDQEVRGDYCICTIPLTVLKKIPADFSPE
MSKAIGSVGYASAGKIGLQFKRRFWEEDEYLYGGSSLTNMDITQIYYPPTDYFGKKGILL
GYYAYGGIADKLGGMSYAEREKLALTQGAKIHPQYPKEFEASFSIDWKKTKYQEGGWVSY
SANDRKTYYPTLCKPDNRIYLAGEHISYITAWQAGAIESAREVVTDIHQRVMKA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
gtggctacaaaagaacaaccaaaagagatgacccggagacaatttctgacgaccgttggc
aaggtgggcggatctgtcgccgtcttcagcttgatgggtacgatggggctccttacgccg
gaaacgttgaaagccgcggaatatactccacccggaaagaatgatctgcatctcagcggc
cggggcggcaagaagattgttattctcggcgcagggatcgcgggcctgacggcagcgtat
gagcttggtctggcaggttacgactgcacgatattggaggcaaaaagctttgccggcggg
cgtaactggacgatccgcaaaggaacctccgtgtcggagatcggatccggccgtcagact
tcccgttttgataacggactgtatttcaatgcaggcccgatgcggattccgcagtttcac
gtcacgctggattattgcaagaagtttggcgtagccatcgagcccttcaacaacgtgaac
gagagcggctattactataacgagaacgtgggggctttgtccggacagcgtgtccccaag
cgtgcagccaaagccgacgtacgcggttacgtggccgagatgctggccaaagccgtgaat
caaaatgcgctggatctgccgctgacggcggaagagaagctgaagctggtggattatctg
aaggccgaaggagatctgaatccggacctgttctacaagggatccgagcgcggcgggtat
aaggatgaaccgggaagccgcctggatgccggcgtgctccgcgatccgttcgatttaaag
gctatcatcaattccggtttcggcaaatatttcagcaacgaatacggttacgaccagcag
atgatgatgtttcaccccataggcggcatggacgccatcgtcaaggcattcgagaaacgg
gtaggcagccggatcaagtaccgggccgaggtgaaggaaattcgccagtcctcctccggc
gtgcggattgtgtatgcggacggccattccggcagagaccaggaagtccgcggcgattac
tgcatctgtaccataccgctgacggtattgaagaagatcccggccgacttctcgccggag
atgtccaaagccatcggcagcgtgggctacgcctccgcaggtaaaatcggtttgcagttc
aagcgccgtttctgggaagaagacgagtatctgtacggcggcagcagcttgacgaatatg
gatattacgcaaatctactatccgccgacagactatttcgggaagaaggggatcctgctc
ggctattatgcgtacgggggcatcgccgataaactcggcggcatgtcgtatgccgagcgc
gagaaactggcattgacgcagggggccaagatccatccgcagtatccgaaggagttcgag
gcctccttctcgatcgactggaagaagaccaaataccaggagggtggctgggtatcctat
tccgccaatgataggaaaacctactacccgaccctctgcaagccggataaccgcatttac
ctggcaggggagcatatcagctacattacggcctggcaggcaggcgccatcgagtccgcc
cgcgaggtcgtaaccgatattcatcaacgcgttatgaaagcataa

DBGET integrated database retrieval system