KEGG   Paenibacillus sp. Y412MC10: GYMC10_0835Help
Entry
GYMC10_0835       CDS       T01100                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    GYMC10_0835
Enzymes [BR:gym01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     GYMC10_0835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
977272..979344
Genome map
AA seq 690 aa AA seqDB search
MKRMFNPISSRVPHMLHGADYNPEQWLRYPEVLEEDIRLMKLANCNVMSVGIFSWVSLEP
EEGVFTFDWLDGVLDRFADNGIYAFLATPSGARPAWMSEKYPEVLRVSERRVRNLHGFRH
NHCYTSPVYREKVHTINRKLAERYGNHPAVIGWHISNEFGGDCHCDYCQDAFRSWLQAKY
ATLDDLNHAWWTAFWSHTITNWSQVESPSPHGETQVHGMNLDWRRFVTDQTADFIRHETE
PLRRVNPSLPVTTNLMEYFEGLNYWKFADLLDVVSWDSYPTWHDQGGDEAAQASRVAMMH
DIVRSIKGGQPWMLMESTPSLTNWQPVSKLKRPGMHLLSSMQAVAHGSDTVQYFQWRKSR
GSSEKLHGAVVDHVGHEHTRVFGDVAEVGDYLNKMDAVVGTGIPAEAAVIFDWENRWAIN
DAQGPRNKGVKYEETVQEHYRALWKQGVPMDVIDMEQDFSGYKLVVAPMLYMVRPGVGER
IQQFVEAGGTFVATYWSGIVDEFDLCFLGGFPGPLRKTLGIWSEEIDALHDHDVNGIVTN
DGGGLGLAEAYEAVELCDLIHLETAEALAVYRSDFYAGRPALTVNQLGKGRAYYIASRNK
EPFHSDFYRKLVEQTGVRRALPMELPSGVSSSIRTDGESDYIFVMNFSGEAKRVTLDGAD
YRDFISCEAQGAELELAPYGVKVIKKGASA
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaatgtttaatccgattagctcgcgggttccgcacatgctgcatggcgccgat
tataatccggagcaatggctccgttatcccgaagtgctcgaagaggatatccggctgatg
aagctggcgaattgcaacgtgatgtccgtcggcatattttcatgggtttcattggagccc
gaggaaggggtattcacgtttgattggcttgacggcgtattggaccgctttgccgacaat
ggaatttatgcttttctggctacgccaagcggcgcaagaccggcctggatgtcggagaag
tatcccgaggtgctgcgcgtaagcgagaggcgcgttcgtaacctgcacggcttccgtcat
aatcactgttatacttcaccggtctatcgggagaaggtccatacgatcaacaggaagctt
gcggagcggtacggcaaccatccagccgtgatcggctggcatatctcgaatgagtttggc
ggcgattgccactgcgactactgtcaggacgcattccggtcttggctgcaggcgaagtac
gccacgctggatgacctcaaccatgcctggtggaccgcattctggagccatacgattacg
aattggagccaggttgaatctccgtcgccgcacggggagacgcaggtacatggaatgaac
ctggattggagacggttcgtaaccgatcagacggcggatttcatccggcacgaaacggaa
cccctccgcagggtcaatccatcccttccggtgacgaccaacctgatggaatattttgaa
ggactgaattactggaagtttgccgatttgctggacgtggtatcctgggacagctatccg
acctggcatgatcagggcggggatgaggccgcgcaggcatcccgcgttgccatgatgcat
gatatcgtccgctcgatcaaaggcgggcagccgtggatgctgatggagagcaccccaagt
ttgacgaactggcagccggtgagcaagctgaagcgcccgggtatgcatttgctgtcttcc
atgcaagccgttgcccatggttcggatacggtgcaatattttcaatggcgcaagagcagg
ggatcgagcgagaagctgcacggcgccgtcgtcgatcatgtcggtcatgaacacacgcgg
gtgttcggcgacgtggctgaggtcggggactatctcaacaagatggatgccgttgtagga
acgggcattccggcggaagcggccgtcatttttgactgggagaaccgctgggccatcaac
gatgcgcaaggtccgcggaataagggagtcaagtatgaggagaccgtgcaagagcattac
cgggctttatggaagcagggagtcccgatggatgtcatcgatatggagcaggatttctcc
ggatataaactggtggtcgcccccatgctgtacatggtgcgcccaggcgtgggcgaacgg
attcaacaatttgtggaagcgggcggcacatttgttgcgacgtattggtcgggaatcgtc
gacgagtttgacctttgcttccttggcggatttccgggtccccttcgtaagacgctcggc
atatggtcggaggaaatcgatgctctccatgatcacgatgtcaatgggatcgtaacgaat
gacggaggggggcttggcttggccgaggcctatgaagccgttgagctgtgcgacctcatt
catctggagacggcggaggcgctggccgtttaccggtccgatttctatgcgggacggcca
gcattgacggtcaatcagcttgggaagggccgggcctattatatcgcctcccggaacaag
gagccttttcattccgatttttacaggaagctcgttgaacagacaggcgtccgccgggcg
ctgccgatggagctgccttcgggcgtaagctcatccattcgtacggatggagagtcagat
tacatttttgtgatgaacttctctggcgaagcgaagcgggtcacgctggacggagccgat
taccgtgattttatctcgtgcgaagcccaaggggcagagctagagttggcgccttacgga
gtgaaggtgatcaaaaaaggggcgagtgcgtaa

DBGET integrated database retrieval system