KEGG   Paenibacillus sp. Y412MC10: GYMC10_0858Help
Entry
GYMC10_0858       CDS       T01100                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gym00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1003109..1003702
Genome map
AA seq 197 aa AA seqDB search
MAGVKDYVNHKVGQNREQIEYHVEQILKLIGEDPKREGLLETPARVTRMYEEIFAGYEVD
PKDVLGVTFDENHEELVIVKDIVYYSQCEHHMAPFFGKVHIGYVPSGKIAGLSKLARLVE
AVTRRLQVQERITSQIADIMVEALQPNGVMVVVEGEHLCMCARGVKKPGSKTVTSAVRGT
FQSDSAQRSEFLSLIKD
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggcgtaaaggactatgtgaaccataaagtaggccaaaaccgggagcagatcgag
taccatgtagagcaaatattgaagctgatcggtgaagatcccaagcgtgagggtctgctt
gagacaccggcccgcgtgacgcggatgtacgaagagatctttgcgggatatgaagtcgat
cccaaggacgttctcggggttaccttcgacgagaatcacgaggaactggtcattgtgaag
gatatcgtgtactacagccagtgtgagcaccatatggcgccgttcttcggcaaagtccat
atcggatatgtcccgagcggcaaaatcgccggcttgagcaagctggcgcgcttggtagag
gcggtaactcgccgtcttcaggtgcaggagcgcatcacctcgcaaatcgccgatattatg
gtggaggcgctgcagcctaacggcgttatggtcgtggtggaaggcgagcatctgtgcatg
tgcgcacgcggcgtgaagaagccgggcagcaagacggtaacgtcggctgtacgcggtacg
ttccagagcgattccgcgcagcgctcggagtttctgtccttgattaaagactaa

DBGET integrated database retrieval system