KEGG   Paenibacillus sp. Y412MC10: GYMC10_0901Help
Entry
GYMC10_0901       CDS       T01100                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
gym  Paenibacillus sp. Y412MC10
Brite
Enzymes [BR:gym01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     GYMC10_0901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1053721..1058172
Genome map
AA seq 1483 aa AA seqDB search
MSKRTIIRKISLMLIAFLLLIPPSWSAAAVEPAQTPADQNLVIHHHFDGGTEGWFKRGTE
TVTSATYAYEGTGSLLTEGRTATWNGPGFNLSATNRLDKGATYEISAYVHLKEGTQGSQK
LQLAMQQTGAEPEYVNFSSPVDVTADGWVEVKGRYKYDANASALQVYLQSPSSPDAAYYM
DDFKVRLIEPAPDPGNGVPGGENTVVWDFEDGTTMDWGPRDSETVEAVPEAAHSGGYGLK
VHDRTNNWNGPSQDVKDIMVSQKTYTISAYARLEQAPAAAVKLSLSMENKAAGAAETSYT
TLASASASGTEWVELKGTFGFSSDMETLKLYVETSDLSNFYVDDIKLALPGSIQTDIPAL
KDVYREYFEIGAAVEPKHLSGVHKELLDYHYNSLVAENVMKPESLNPREGTYNFTNADLI
RDYARDHDMNLRFHTLLWHQQGAEWMLKDDQGQYLEATPENKALVLQRLEAYIHEVAGRY
KGDVRDWDVVNEVIDEGRPDGMRDSQWYRITGLDYIRTAFHAARDAAGPEAKLYINDYST
HNPKKRDYLLNLVKQLKAEGVPIDGVGHQTHINISGPSIQQISDSIRMFGEAGFDNQLTE
LDVSVYTNNTDAFQTVPQELLDKQGYRYKELFEELKRLDQMGVDAGVEGGWISNVTLWGI
ADDHTWLHDRPAGTGRQDAPFPFDKQYQAKPAYWGMVDPSRLTIVRKTGMAVEGKAVIDG
QPDAAWNLVPSLRTEKLGSLSAEFKTLWDKDHIYVRVDVKDGSIAPGDQVDIFAVVNGTL
QEARIQRGAANTAETAGGYAGEALLQLHGTGALGGDIYFDVRVTDSGSDDGSEHGKNGAV
VSWSDPRHAQESDQDGLGILTLAAAPKSAQARYGTPKVDGELDVVWKDAAELATDVWVEG
NSGATATFRTLWDENYLYVYAIVSDSLLSDASPNVWEQDSVEIFVDQNNGKTDAYQEDDG
QYRMNFNNLRSFGGYAGEDNFTSAAKVIDGGYVVEAAIRLDKIKPEKGTVIGFDLQVNND
EDGQGTRDSVAIWSDPTGQSYQNTSRFGVLEFTKSSAPGGGDGNGGEHNGGGDGGSGANA
GGGGSSTSPAPNTPSLEIRNNDGRILAVVSSQVLQQALDRAAAGVEGPKRAIVAIPAQTE
AQSYEIQLPGKWLLGNSEVVLILQTEFGALELPSAWVRGAGVKDTETVALRLAKASGSNL
GAALREEIGDRPVFRIEALAGDRALSWKSGKARLIWSVPYTPTKEELAQPDHIFVREIDA
NGQGGPLANSRYDAKQGIVRAALPHGGTFAVASAFKTFHDLKHVPWAIDAIETMASRGFI
QGVSETMFDPQNEITRAEFLVMLVRVLELEGSSEGRAAFGDVTSAAYYYKHVQIAAELGL
VQGVGGNRFSPDTPMTRQDMMLITQRALEAAGKKLEGEGALDAFADGDEVAEYAKSSAAL
LAGSGIVNGMNGKIAPKAYFTRAQAAVILDRIWNWELIKAVNR
NT seq 4452 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaagagaacgatcattagaaagatcagcctgatgctgatcgcgttcttgctgctt
attccgcctagctggagcgcggcggcagttgaaccggcccaaacgcccgctgatcagaat
cttgtgattcaccatcatttcgatggcgggacggaggggtggttcaaacgggggacggag
acggtgacttccgctacctatgcttatgaaggaacagggagcttgctgacggagggaagg
acagcgacctggaacggaccggggtttaatctatccgccacgaatcggctggacaaggga
gcgacatatgaaatttccgcttatgtccatctgaaggagggcacccaagggtctcagaag
cttcagcttgccatgcagcaaaccggggccgagccggaatacgtgaacttcagcagcccg
gtcgatgtaaccgccgacgggtgggtggaggtaaaaggccgttataaatacgatgccaat
gcatcagccctgcaggtgtatttgcagagtccgagcagtccggacgccgcttattatatg
gacgacttcaaagtccggctgattgagccggcaccggacccgggcaatggggtgccggga
ggagagaatacggtcgtatgggattttgaagacggaacgacgatggattggggacctcgc
gattcggagaccgtagaagctgtgccagaagcagcccatagcggcggctacggtttaaag
gtccatgatcggacgaacaactggaacgggcccagccaggacgtcaaagacatcatggtg
agccaaaaaacgtatacgatctcagcctatgccaggcttgagcaggctcctgccgctgcg
gtcaaactatcgctttcgatggagaataaagcggcgggcgcagcagagacgtcttatacg
accctcgcctcagcctccgcgagcggcacggagtgggtggaactgaaaggaaccttcggc
ttcagctcggatatggaaaccttgaagctgtacgtggaaacctcggatctttccaatttc
tatgtcgatgacattaagctcgctctgccgggctccattcagacggatattcccgccctg
aaggatgtgtatcgggagtatttcgagatcggggcagccgtggagcccaagcatctgtcc
ggcgtgcacaaggagcttctggattatcattacaactcgcttgttgccgagaacgtgatg
aaaccggaatctctcaatccgagagagggaacctataactttaccaacgcggatctgatc
agggattatgccagggatcatgatatgaacctccggttccatacgctgctgtggcatcag
caaggcgccgaatggatgctgaaggatgatcagggccaatatcttgaagccacgccggag
aacaaagcgctcgtccttcagaggctggaagcttatatccatgaggtggccggccgttac
aagggagatgtccgcgattgggacgtcgtgaatgaggttattgacgaagggcgtccggac
ggcatgcgggacagccagtggtaccggataacgggactcgactatatccggaccgcattt
catgcggcgcgagacgcagccggacccgaggccaagctgtacatcaacgattacagcacg
cacaacccgaagaaacgcgattatttgctgaatctcgtaaaacagctgaaggcggaaggc
gttccgatcgatggcgtgggccatcaaacgcatatcaatatcagcgggccctccatccag
caaatctcggattccatccggatgttcggcgaggcgggctttgataatcagcttaccgag
ctggacgtttcggtgtacacgaacaataccgacgccttccagaccgttcctcaggaattg
ctcgacaagcaaggctatcggtacaaagagctgtttgaagaattgaagcggctggaccaa
atgggcgttgatgcaggcgtggagggtggctggatcagcaatgtcactctttgggggatt
gcagacgaccatacctggctgcatgaccgtcccgccgggacgggccgccaggatgccccg
tttccttttgacaagcaatatcaggccaagccagcttattggggaatggtcgatccctcc
aggctaacgattgtgagaaaaaccggaatggctgtggagggtaaggccgtcatcgacgga
caaccggatgctgcctggaatctggttccgtcacttaggacggagaagctaggatcgttg
tctgccgaatttaagacgctatgggacaaggaccatatctatgtcagggttgacgtgaaa
gacggatcgatagccccaggggatcaggttgatatcttcgcggtggtgaacggtaccctg
caagaggcccggattcagcgtggagccgccaacacggcagagaccgcgggaggttacgcg
ggggaggctcttctccagctacacggaacaggggcattgggcggcgacatttatttcgat
gtcagggtaacggattccggttcggatgacggttccgagcatggcaagaatggagcggtg
gtgtcctggagcgatccaaggcatgcccaggagagcgatcaagacggactcggcattctt
acgctcgctgctgcgccgaaatcggcccaggcccgctacggcaccccgaaggtggacggc
gagctggacgtggtctggaaggacgccgcggaactggcaaccgacgtgtgggtcgagggt
aacagcggcgcgaccgcaacattccggacgctatgggatgagaattacctgtatgtttac
gccatagttagcgacagcttgttgtcggatgcgagtcccaacgtatgggagcaggattcg
gtagagatttttgtggatcagaataatggaaagacggatgcttaccaagaagatgatgga
cagtaccggatgaacttcaacaatctgcgttcctttggcggttatgcgggcgaggataac
ttcacttcggcagcgaaggtgatcgacgggggatatgtcgttgaagcagcgatccgcctc
gacaagatcaagcctgagaaagggacggtcatcggattcgatttgcaggtgaacaacgat
gaagacggccagggcacaagagacagcgtggccatctggtcggatccgacgggccagtcc
tatcagaacacgtccaggttcggcgtgctggaattcacgaagagctccgctcctggcgga
ggagacggaaacggcggagaacataacggcggcggtgacggaggaagcggtgcaaacgcg
ggcggaggcggaagcagtacaagtccagctccaaacacgccttcactcgaaatccggaac
aacgacgggcggattctcgctgtagtctcgagccaagtccttcagcaggcattggatagg
gcggcagccggtgtggaaggaccgaagcgagcaatcgtggctatcccggctcaaacagag
gcccagtcctacgaaattcaattgccgggcaagtggctgctggggaactcggaggttgtg
ttgatcctccaaacggagttcggcgcactggagctgccaagcgcatgggttcggggagcc
ggagtaaaggatacggaaaccgtcgcgctgcgtctggcgaaagcttcgggcagcaatctg
ggtgcagcccttcgcgaggagatcggtgatcgtccggtgttccggatagaggctcttgcc
ggcgaccgggccctgtcgtggaaatcgggcaaagctcgcctgatctggtcggtgccttac
acaccaaccaaggaagagctggcacaaccggatcatatctttgtcagggagatcgatgcc
aacgggcaaggcgggcctcttgctaacagccgttatgatgcgaaacaggggatcgttcgc
gcagcgctgccgcatggcggcacgtttgcagtcgcttccgcattcaagacgtttcatgac
ctgaagcatgtgccgtgggcgatcgatgcgatcgaaacgatggcatcccgcggatttatc
caaggggtaagcgaaacgatgttcgatccgcagaacgaaatcacccgggccgaattcctc
gttatgctcgtacgcgtgctggaactggaaggctcgagcgaaggccgggcagcattcgga
gatgttacgtctgcggcctattattacaaacacgtgcaaatcgccgcagagcttgggctc
gttcaaggcgtcggcggaaatcgtttctcgccggacacgccgatgacgcgccaggacatg
atgctgatcacgcagcgtgccctggaggcggcaggcaagaagctggagggcgaaggggcg
ctggatgcttttgccgatggggatgaggttgccgaatatgccaaatcgagtgcagctctg
cttgcagggtcgggcatcgtgaacggcatgaacggcaaaatcgcgccgaaggcttacttt
acgcgtgcccaggcagccgtgattctggaccggatttggaattgggaactgattaaggcc
gtgaatcgttaa

DBGET integrated database retrieval system