KEGG   Paenibacillus sp. Y412MC10: GYMC10_1000Help
Entry
GYMC10_1000       CDS       T01100                                 

Definition
pyruvate/ketoisovalerate oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYMC10_1000
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC10_1000
   00020 Citrate cycle (TCA cycle)
    GYMC10_1000
   00620 Pyruvate metabolism
    GYMC10_1000
   00640 Propanoate metabolism
    GYMC10_1000
   00650 Butanoate metabolism
    GYMC10_1000
  Energy metabolism
   00680 Methane metabolism
    GYMC10_1000
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    GYMC10_1000
Enzymes [BR:gym01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     GYMC10_1000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1177870..1178892
Genome map
AA seq 340 aa AA seqDB search
MSILPQKNELGFFEIRLESIGGLGANLAGKMLAEAGVTGSGLNGSNFSSYGSEKKGSPVK
SFVRFCDPEVEIRDHSPIEQPHVVGVFHEALYKTIDVISGLQPDGTVLVNTARALSEVAI
DLNMTQGTLAVVDALNISVEEKTKVNTAMLGALFRICSFLDPDDMRQVIRTTFEKKLPHL
VEANVRTFDRGYNEVRFLSLGNGSALIDPIAFARPQPILGYETQELGGILNVTANSVLKD
LSGSRQGYLPEYKIEDCIHCAACDTVCPDFCIVWETKPDKRGNMQMFMKGIDYQYCKGCL
KCIEACPTTALAALLEEPHYAEQHRVPQSFPYLTAEGVRS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattttgcctcaaaagaatgaactgggatttttcgagatccgtctcgaatccatc
ggcgggcttggcgccaatctggccggaaaaatgctggccgaagccggggtcaccggctcc
ggacttaacggttcgaatttttccagctatggttcggagaaaaaagggtcgccggtgaag
agcttcgtaaggttctgcgatcccgaggtggaaatccgcgatcacagtcccattgagcag
ccgcatgtcgtcggcgtatttcatgaagccttgtataagacgatcgatgtcataagcgga
ttacagcctgatggaacggtgcttgtgaatacggcgcgagcgctgtccgaagtggccatt
gatctgaacatgacccagggaacgctggccgtagttgatgcgctgaacatttccgttgag
gaaaaaaccaaagtgaatacggccatgcttggggctttgttccggatttgcagctttcta
gacccggacgatatgcggcaggtgatccgcacaacatttgagaaaaagctgccccacctc
gtggaagcgaatgtgcggacctttgacagaggatataacgaagtccggttcctttccttg
ggaaacggctcagcgcttatagacccaatcgctttcgcaagaccgcagccgattcttgga
tatgaaacgcaggagctgggcgggattctgaacgttacggcgaacagtgtcctgaaggat
cttagcggctcccggcagggatatttgccagagtacaagatcgaggactgcattcactgt
gccgcctgcgatacggtatgtccggatttctgcatcgtgtgggagacgaagccggataag
cgcgggaatatgcagatgtttatgaaaggtatcgattatcagtattgcaaaggctgcctg
aagtgtatcgaagcttgtccgaccaccgctttggctgccctgttagaagaaccgcattat
gcggagcagcaccgtgtgccgcaatcgtttccctatttaactgcggagggagtccgatca
tga

DBGET integrated database retrieval system