KEGG   Paenibacillus sp. Y412MC10: GYMC10_1000Help
Entry
GYMC10_1000       CDS       T01100                                 

Definition
pyruvate/ketoisovalerate oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:gym01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gym00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:gym00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gym00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:gym00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:gym00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:gym00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1177870..1178892
Genome map
AA seq 340 aa AA seqDB search
MSILPQKNELGFFEIRLESIGGLGANLAGKMLAEAGVTGSGLNGSNFSSYGSEKKGSPVK
SFVRFCDPEVEIRDHSPIEQPHVVGVFHEALYKTIDVISGLQPDGTVLVNTARALSEVAI
DLNMTQGTLAVVDALNISVEEKTKVNTAMLGALFRICSFLDPDDMRQVIRTTFEKKLPHL
VEANVRTFDRGYNEVRFLSLGNGSALIDPIAFARPQPILGYETQELGGILNVTANSVLKD
LSGSRQGYLPEYKIEDCIHCAACDTVCPDFCIVWETKPDKRGNMQMFMKGIDYQYCKGCL
KCIEACPTTALAALLEEPHYAEQHRVPQSFPYLTAEGVRS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattttgcctcaaaagaatgaactgggatttttcgagatccgtctcgaatccatc
ggcgggcttggcgccaatctggccggaaaaatgctggccgaagccggggtcaccggctcc
ggacttaacggttcgaatttttccagctatggttcggagaaaaaagggtcgccggtgaag
agcttcgtaaggttctgcgatcccgaggtggaaatccgcgatcacagtcccattgagcag
ccgcatgtcgtcggcgtatttcatgaagccttgtataagacgatcgatgtcataagcgga
ttacagcctgatggaacggtgcttgtgaatacggcgcgagcgctgtccgaagtggccatt
gatctgaacatgacccagggaacgctggccgtagttgatgcgctgaacatttccgttgag
gaaaaaaccaaagtgaatacggccatgcttggggctttgttccggatttgcagctttcta
gacccggacgatatgcggcaggtgatccgcacaacatttgagaaaaagctgccccacctc
gtggaagcgaatgtgcggacctttgacagaggatataacgaagtccggttcctttccttg
ggaaacggctcagcgcttatagacccaatcgctttcgcaagaccgcagccgattcttgga
tatgaaacgcaggagctgggcgggattctgaacgttacggcgaacagtgtcctgaaggat
cttagcggctcccggcagggatatttgccagagtacaagatcgaggactgcattcactgt
gccgcctgcgatacggtatgtccggatttctgcatcgtgtgggagacgaagccggataag
cgcgggaatatgcagatgtttatgaaaggtatcgattatcagtattgcaaaggctgcctg
aagtgtatcgaagcttgtccgaccaccgctttggctgccctgttagaagaaccgcattat
gcggagcagcaccgtgtgccgcaatcgtttccctatttaactgcggagggagtccgatca
tga

DBGET integrated database retrieval system