KEGG   Paenibacillus sp. Y412MC10: GYMC10_1370Help
Entry
GYMC10_1370       CDS       T01100                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    GYMC10_1370
  Lipid metabolism
   00561 Glycerolipid metabolism
    GYMC10_1370
   00600 Sphingolipid metabolism
    GYMC10_1370
Enzymes [BR:gym01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     GYMC10_1370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1627768..1629267
Genome map
AA seq 499 aa AA seqDB search
MSFKVAFIGAGSIGFTRGILRDLLTVPEFRDIEVAFTDISRHNLEMVTELCQRDINENGL
SIAIQSTTDRRQALQDAKYVICTIRVGGLEAFRTDVDIPLKYGIDQCVGDTLCAGGIMYG
QRGIPEMLNICRDIREVCAPDVLLLNYSNPMAMLTWACNRYGGVRTVGLCHGVQHGHHQI
AEVYGLKKQDVDIVCAGINHQTWYIQASHQGKDLTAGLLEAFERHPEYSRTEKVRIDMLR
RFGYYSTESNGHLSEYVPWYRKRPEEITEWIDLSSWINGETGGYLRVCTEGRNWFETDFP
NWMKDPAMEFKPEHRGEEHGSYIIEGLETGRVYRGHFNVVNEGIIANLPEDAVIEAPGYV
DRNGISMPLVGNLPLGPAAVCSVSISVQRLAVEAAVHGDDKLLRQAFMMDPLVGAVCNPK
EIWQLVDEMLVAGEAWLPQYSASIAEAKERLAAGNLIPTRSYEGAARLKVKTVEEMQLDR
EKANKNAGESDKGKDREKV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttaaggttgcttttatcggagcgggaagcatcggctttacccgggggattctg
cgcgatttgctgaccgtaccggagttccgggatatcgaggtcgctttcaccgacatcagc
cggcataacttggagatggtcacggaattatgtcagcgggacattaatgagaacgggctg
tcgattgcgatccagtccaccacggatcgaaggcaggcactgcaggatgccaaatacgtc
atttgcaccatccgcgtgggcggtctggaggcattccgcacggatgtggacattccgctg
aaatacggcatcgatcagtgcgtgggcgacacgctctgcgcaggaggcatcatgtacggc
cagcggggaatccccgagatgctgaacatctgccgggatattcgcgaggtgtgcgcgccc
gatgtcctgctgctgaattactcgaatccgatggccatgctgacatgggcatgcaatcgg
tatggaggcgtgcggacggtgggtttatgccatggcgtgcagcatgggcaccaccagatt
gccgaggtttacggtttaaagaaacaggacgtcgatattgtctgtgccggaatcaatcat
cagacttggtatattcaagcttcgcatcaaggcaaagacttgacggccgggctgctggag
gcgttcgagcgccatcccgaatacagcaggacggagaaggtccgcatcgatatgctccgg
cgtttcggatattacagcaccgaatccaacggccatctaagcgaatacgtgccttggtac
cgtaaacggccggaggaaattacggagtggattgatctcagcagctggatcaacggagag
acgggcgggtatttgcgagtttgcaccgaggggcgcaactggttcgagaccgatttcccg
aactggatgaaggatccggcaatggaattcaagccggagcaccggggagaggagcacggc
tcctacatcattgaaggcttggagaccggcagggtataccgtggacactttaatgtggtg
aatgaaggcattatcgccaacctgccggaggatgccgtcatcgaggcaccgggatacgtt
gaccgcaatggcatttccatgccgcttgtcgggaatttgcctcttggcccggctgccgta
tgcagcgtaagcatatccgttcaacggctggcggttgaagcggcggttcatggagatgac
aagctgcttcggcaggcgtttatgatggatccgctggtcggtgcggtatgcaatccgaag
gaaatctggcagctggtcgatgaaatgctggtagccggtgaagcatggcttcctcagtat
tcggcttcgatcgccgaggcgaaggaacgtctggcggccggcaatctgatcccgacccgc
tcgtatgaaggcgcagccagactcaaggtgaaaacggtggaggagatgcagctcgatcgg
gagaaagcgaataaaaacgcaggtgaatccgataaagggaaagatcgcgaaaaagtgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system