KEGG   Paenibacillus sp. Y412MC10: GYMC10_1370Help
Entry
GYMC10_1370       CDS       T01100                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gym00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:gym00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:gym00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1627768..1629267
Genome map
AA seq 499 aa AA seqDB search
MSFKVAFIGAGSIGFTRGILRDLLTVPEFRDIEVAFTDISRHNLEMVTELCQRDINENGL
SIAIQSTTDRRQALQDAKYVICTIRVGGLEAFRTDVDIPLKYGIDQCVGDTLCAGGIMYG
QRGIPEMLNICRDIREVCAPDVLLLNYSNPMAMLTWACNRYGGVRTVGLCHGVQHGHHQI
AEVYGLKKQDVDIVCAGINHQTWYIQASHQGKDLTAGLLEAFERHPEYSRTEKVRIDMLR
RFGYYSTESNGHLSEYVPWYRKRPEEITEWIDLSSWINGETGGYLRVCTEGRNWFETDFP
NWMKDPAMEFKPEHRGEEHGSYIIEGLETGRVYRGHFNVVNEGIIANLPEDAVIEAPGYV
DRNGISMPLVGNLPLGPAAVCSVSISVQRLAVEAAVHGDDKLLRQAFMMDPLVGAVCNPK
EIWQLVDEMLVAGEAWLPQYSASIAEAKERLAAGNLIPTRSYEGAARLKVKTVEEMQLDR
EKANKNAGESDKGKDREKV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttaaggttgcttttatcggagcgggaagcatcggctttacccgggggattctg
cgcgatttgctgaccgtaccggagttccgggatatcgaggtcgctttcaccgacatcagc
cggcataacttggagatggtcacggaattatgtcagcgggacattaatgagaacgggctg
tcgattgcgatccagtccaccacggatcgaaggcaggcactgcaggatgccaaatacgtc
atttgcaccatccgcgtgggcggtctggaggcattccgcacggatgtggacattccgctg
aaatacggcatcgatcagtgcgtgggcgacacgctctgcgcaggaggcatcatgtacggc
cagcggggaatccccgagatgctgaacatctgccgggatattcgcgaggtgtgcgcgccc
gatgtcctgctgctgaattactcgaatccgatggccatgctgacatgggcatgcaatcgg
tatggaggcgtgcggacggtgggtttatgccatggcgtgcagcatgggcaccaccagatt
gccgaggtttacggtttaaagaaacaggacgtcgatattgtctgtgccggaatcaatcat
cagacttggtatattcaagcttcgcatcaaggcaaagacttgacggccgggctgctggag
gcgttcgagcgccatcccgaatacagcaggacggagaaggtccgcatcgatatgctccgg
cgtttcggatattacagcaccgaatccaacggccatctaagcgaatacgtgccttggtac
cgtaaacggccggaggaaattacggagtggattgatctcagcagctggatcaacggagag
acgggcgggtatttgcgagtttgcaccgaggggcgcaactggttcgagaccgatttcccg
aactggatgaaggatccggcaatggaattcaagccggagcaccggggagaggagcacggc
tcctacatcattgaaggcttggagaccggcagggtataccgtggacactttaatgtggtg
aatgaaggcattatcgccaacctgccggaggatgccgtcatcgaggcaccgggatacgtt
gaccgcaatggcatttccatgccgcttgtcgggaatttgcctcttggcccggctgccgta
tgcagcgtaagcatatccgttcaacggctggcggttgaagcggcggttcatggagatgac
aagctgcttcggcaggcgtttatgatggatccgctggtcggtgcggtatgcaatccgaag
gaaatctggcagctggtcgatgaaatgctggtagccggtgaagcatggcttcctcagtat
tcggcttcgatcgccgaggcgaaggaacgtctggcggccggcaatctgatcccgacccgc
tcgtatgaaggcgcagccagactcaaggtgaaaacggtggaggagatgcagctcgatcgg
gagaaagcgaataaaaacgcaggtgaatccgataaagggaaagatcgcgaaaaagtgtaa

DBGET integrated database retrieval system