KEGG   Paenibacillus sp. Y412MC10: GYMC10_1396Help
Entry
GYMC10_1396       CDS       T01100                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYMC10_1396
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC10_1396
   00052 Galactose metabolism
    GYMC10_1396
   00500 Starch and sucrose metabolism
    GYMC10_1396
   00520 Amino sugar and nucleotide sugar metabolism
    GYMC10_1396
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GYMC10_1396
   00524 Butirosin and neomycin biosynthesis
    GYMC10_1396
Enzymes [BR:gym01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GYMC10_1396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1661025..1661987
Genome map
AA seq 320 aa AA seqDB search
MGYAIGVDIGGTKVQFAVIDRGGEIINRHRVPTEAHKGPEQLMHKVLLGIDMMMKSAGAE
GEVQGIGIGSAGQIDFREGTVLYAGDTLPDWTGTAIKRLVTQRYNTRVYVDNDVNVIAMA
EKMYGVGKHCDNFVCLALGTGIGGAVMESGRLLRGVFGGAAELGHVSVDINGPRCSCGNN
GCIELYASGSGIARIGLEMQRDESASYAWRPNSRDIIRAWHQDDPSATAVMRVVIRALGA
AVAGYIHAFNPEVVVIGGGVAESGPRFLQELDQEIDARTSSYMRSCCRIMAASFGNDAGV
IGAAAQVWFYGEMECMQYVI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgggttacgccatcggcgttgatattggggggacgaaagtccaatttgcggtcatcgat
cgagggggggagatcataaaccggcatcgggtgccaaccgaggcccataaaggtccagag
cagcttatgcacaaagtgctgcttggcatcgacatgatgatgaaatcggccggcgctgag
ggagaggtgcaagggatcggcatcggcagcgcaggccagatcgattttcgggaagggacc
gttctatacgcgggagatacgcttcccgactggacggggacggcaattaaacggctggta
acacagcgttataacactcgtgtgtatgtggacaatgatgtcaatgtcattgcgatggcg
gagaagatgtacggggttggcaaacactgcgataattttgtgtgcttggctcttggcacc
ggcatcggcggtgccgtcatggaatcaggacgccttctgcgaggcgtctttggcggggcg
gcggagctcggccatgttagtgttgacattaacggccctcgctgcagctgcggaaataac
ggatgcatcgagctgtatgcctccggaagcgggattgccagaataggtcttgaaatgcaa
agggatgaaagcgcttcatatgcatggaggcctaattcccgggatattattcgggcttgg
catcaggatgatccatccgccacggcggtcatgcgggtggtcatccgggcgctgggagct
gctgttgccgggtatattcatgcctttaatccggaggtcgttgtgatcggaggcggagtt
gcggagtccggtccccgttttttgcaggagctcgatcaggaaatcgatgctcgaacgtct
tcgtatatgagaagctgctgccggattatggctgcgagttttggcaatgacgccggcgtt
ataggagcggcggcccaagtatggttttacggtgagatggaatgtatgcaatacgtcata
tag

DBGET integrated database retrieval system