KEGG   Paenibacillus sp. Y412MC10: GYMC10_1396Help
Entry
GYMC10_1396       CDS       T01100                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym00010  Glycolysis / Gluconeogenesis
gym00052  Galactose metabolism
gym00500  Starch and sucrose metabolism
gym00520  Amino sugar and nucleotide sugar metabolism
gym00521  Streptomycin biosynthesis
gym01100  Metabolic pathways
gym01110  Biosynthesis of secondary metabolites
gym01120  Microbial metabolism in diverse environments
gym01130  Biosynthesis of antibiotics
gym01200  Carbon metabolism
Module
gym_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gym_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC10_1396
   00052 Galactose metabolism
    GYMC10_1396
   00500 Starch and sucrose metabolism
    GYMC10_1396
   00520 Amino sugar and nucleotide sugar metabolism
    GYMC10_1396
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GYMC10_1396
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GYMC10_1396
Enzymes [BR:gym01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GYMC10_1396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase FGGY_N BcrAD_BadFG Hydant_A_N DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: ACX63682
JGI: GYMC10_1396
UniProt: D3EJL0
Position
1661025..1661987
Genome map
AA seq 320 aa AA seqDB search
MGYAIGVDIGGTKVQFAVIDRGGEIINRHRVPTEAHKGPEQLMHKVLLGIDMMMKSAGAE
GEVQGIGIGSAGQIDFREGTVLYAGDTLPDWTGTAIKRLVTQRYNTRVYVDNDVNVIAMA
EKMYGVGKHCDNFVCLALGTGIGGAVMESGRLLRGVFGGAAELGHVSVDINGPRCSCGNN
GCIELYASGSGIARIGLEMQRDESASYAWRPNSRDIIRAWHQDDPSATAVMRVVIRALGA
AVAGYIHAFNPEVVVIGGGVAESGPRFLQELDQEIDARTSSYMRSCCRIMAASFGNDAGV
IGAAAQVWFYGEMECMQYVI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgggttacgccatcggcgttgatattggggggacgaaagtccaatttgcggtcatcgat
cgagggggggagatcataaaccggcatcgggtgccaaccgaggcccataaaggtccagag
cagcttatgcacaaagtgctgcttggcatcgacatgatgatgaaatcggccggcgctgag
ggagaggtgcaagggatcggcatcggcagcgcaggccagatcgattttcgggaagggacc
gttctatacgcgggagatacgcttcccgactggacggggacggcaattaaacggctggta
acacagcgttataacactcgtgtgtatgtggacaatgatgtcaatgtcattgcgatggcg
gagaagatgtacggggttggcaaacactgcgataattttgtgtgcttggctcttggcacc
ggcatcggcggtgccgtcatggaatcaggacgccttctgcgaggcgtctttggcggggcg
gcggagctcggccatgttagtgttgacattaacggccctcgctgcagctgcggaaataac
ggatgcatcgagctgtatgcctccggaagcgggattgccagaataggtcttgaaatgcaa
agggatgaaagcgcttcatatgcatggaggcctaattcccgggatattattcgggcttgg
catcaggatgatccatccgccacggcggtcatgcgggtggtcatccgggcgctgggagct
gctgttgccgggtatattcatgcctttaatccggaggtcgttgtgatcggaggcggagtt
gcggagtccggtccccgttttttgcaggagctcgatcaggaaatcgatgctcgaacgtct
tcgtatatgagaagctgctgccggattatggctgcgagttttggcaatgacgccggcgtt
ataggagcggcggcccaagtatggttttacggtgagatggaatgtatgcaatacgtcata
tag

DBGET integrated database retrieval system