KEGG   Paenibacillus sp. Y412MC10: GYMC10_1520Help
Entry
GYMC10_1520       CDS       T01100                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GYMC10_1520
Enzymes [BR:gym01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     GYMC10_1520
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     GYMC10_1520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1796749..1798308
Genome map
AA seq 519 aa AA seqDB search
MAGKVYLVGAGPGDARLITIKGKECIEKADVVVYDRLASPRLLRWMKPGAEKVYVGKLPD
RHTMKQEQINQLLVDYALEGKTVVRLKGGDPTIFGRVGEEAELLYRHGIMYEIVPGITSA
ISVPAYAGIPVTHRDHASSLSIITGHESPEKLDRMIQWDKVTHATGTFIFMMGVAKIGYI
SRQLMKHGRPPETPVALIRWGTRAEQDTLTGTLADIEDKVKAADFQPPAVIVVGEVVLQR
EHLKWAERLPLFGKRILVTRARSQASSLVSQIEELGGEPYEFPVIETVMPSKGEGLAGIQ
EALDKLGTYDWVFFTSVNGVEFFFRHLKEHGRDIRSLASARIVAVGPATADALGNYGISA
ELIKERYQAEGLIDAYGPELQPGQRVLLPRGDLARRWLPEKLMEMGLHVTEAVIYENVLC
GEDDDELLKLLQDGGIHAVTFTSSSTVTNLLKVLKGMGVAEPADLLKESTIACIGPLTAQ
TAEKAGLHVSLLAEEATVDSLVKALCVWNESDPRRITTP
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaaggtttatctcgtgggagcaggtccgggcgatgcgcgcctgattacgatc
aaaggcaaggaatgcattgaaaaagcggatgtcgtggtctatgaccgattagccagtcct
cggctgctgcgctggatgaaacccggagcggagaaggtctacgtgggcaagcttccggat
cggcatacgatgaaacaggaacagatcaatcaactgctggtggattatgctttggaaggc
aagacggtggtccggttaaagggcggcgatcccacgatcttcggaagagtcggcgaagaa
gcggagctgttatatcgtcatggcatcatgtacgagatcgtcccggggatcacctcggcg
atcagtgtgccggcttatgcaggaattccggtgacgcatcgcgatcatgcctcatcctta
tccatcattacaggacatgaaagccccgagaagctggatcgcatgattcaatgggataag
gtgacccatgcgacggggacttttatttttatgatgggcgtggcgaagatcggttatatc
agccgtcagctgatgaagcatggaaggcctccggaaacgccggtggctctaataagatgg
ggaacccgggcggagcaggatacgctgacgggaacgctggcagacatcgaggacaaggtc
aaggcagcggattttcagccacctgccgtcatcgtcgttggcgaggtggtgcttcagcgg
gagcacttgaagtgggcggaacggctgcccctgttcggcaaaaggattctggtcacgagg
gcccgaagccaagccagttcattggtatcccaaatcgaggagcttggcggggagccttat
gagtttcccgtcattgaaacggtgatgccctcgaagggcgaggggcttgccggaattcaa
gaagcgctggacaagctgggtacgtatgattgggtgttcttcaccagcgtaaacggcgtc
gagtttttcttccgccacctgaaggagcatggacgcgatattcgctctttggcctcggca
cgcatcgtcgcggtaggtcccgcaacagccgatgctcttgggaattacggtatatccgcc
gagttgatcaaggagcgttaccaggcggagggccttatcgatgcttacggtccagagctt
cagccgggccagcgcgtgctgctgcctcgcggcgatctcgcgcgcagatggctgccggag
aagcttatggaaatgggactgcacgtgacggaagccgtgatatacgagaacgtgctgtgc
ggcgaggacgatgatgagctgctgaagctgcttcaagacggcggcattcatgcggtcacg
ttcaccagttcttctacggttaccaatctgctgaaagtgctgaaggggatgggcgtggca
gagcctgccgatctgctgaaggaatcgacgattgcttgcatcggaccgctgaccgcgcaa
accgcggagaaagccggactgcacgtatcgctcctcgccgaggaagcgacggtcgacagt
ctggtcaaggccttgtgtgtttggaacgagagcgatccacgccgtataacgacgccataa

DBGET integrated database retrieval system