KEGG   Paenibacillus sp. Y412MC10: GYMC10_1521Help
Entry
GYMC10_1521       CDS       T01100                                 

Definition
Porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GYMC10_1521
Enzymes [BR:gym01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     GYMC10_1521
Exosome [BR:gym04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GYMC10_1521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1798364..1799362
Genome map
AA seq 332 aa AA seqDB search
MSFPIVRHRRLRQNAGIRSMVRETVLHTEDLVQPIFVTYGSGVKSEISSMPGVYHFSLDT
LKEEVDEIVNLGIPAVLLFGIPETKDSVGTSGFADDGIVQEATRLIKSWHPDLLVIADTC
LCEFTDHGHCGMVHTFERDGHTCGDVLNDESLELLVRTAVSQAKAGADIIAPSNMMDGFV
QAIRSGLDEAGFYNVPIMSYSVKYASAFYGPFREAADSAPQFGDRKTYQMDPANVREALR
EAETDVLEGADMLMVKPAMAYLDVVRLLRDQFDLPIVAYNVSGEYSMIKAAAQQGWISEQ
AIVMELLTGMKRAGADIIITYFSKDAARWMRG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagttttccaatcgtacgccatcgccggctgcgtcaaaatgccggcattcgcagcatg
gtccgggagaccgtgcttcatacggaggatctggttcagccgatcttcgtgacctatggc
agcggtgtgaaatccgaaatttcctcgatgccgggcgtatatcatttttcgctggatacc
ttgaaggaagaagtggacgaaatcgtaaatctagggattcctgccgtgctcctgttcggg
attcctgagacaaaagacagtgtaggcacgtccggtttcgcggatgacggaatcgtccaa
gaggccacccgcctcattaagtcgtggcatcccgatcttctggtcattgcggacacgtgc
ctgtgcgaattcaccgaccacggccactgcggcatggtccataccttcgagcgagacggt
cacacctgcggcgacgtattaaacgacgagtcgctggagctgctcgttcgtacggcggtc
tcccaggcgaaagcgggagccgatatcatcgcaccttccaatatgatggacggctttgtc
caagccattcgttccggactcgatgaagccggattttataatgtgccgatcatgtcgtat
tcggttaagtatgcttcggctttttacggtccattccgcgaagccgcagactccgctccg
cagttcggcgaccgcaaaacctatcaaatggatccagctaacgtaagggaagcgctccgc
gaggcggagacggacgtgctggaaggcgcggatatgctgatggtgaagccggcgatggct
tacctcgacgttgtccgattgctgagagaccagtttgatctgccgatcgtcgcttacaac
gtgagcggcgagtattccatgatcaaggcggcggctcagcagggatggatcagtgagcag
gcgatcgtgatggagctgctgacggggatgaagcgtgccggtgcggacattatcattacg
tatttctcgaaggatgcggcacgctggatgcgcggctag

DBGET integrated database retrieval system