KEGG   Paenibacillus sp. Y412MC10: GYMC10_1551Help
Entry
GYMC10_1551       CDS       T01100                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GYMC10_1551
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GYMC10_1551
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GYMC10_1551
Enzymes [BR:gym01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GYMC10_1551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1829293..1830366
Genome map
AA seq 357 aa AA seqDB search
MPYEGLLQTYREYLPVNERTPLLTLKEGNTPLIKAVNLSEELGIDLHFKFEGLNPTGSFK
DRGMVMAVAKAMEEGSRTIMCASTGNTSAAAAAYAARGGLNCIVIIPNNNIALGKLAQAM
IYGAKVIAIEGNFDRALEIVREITAKHPISLVNSVNPYRIEGQKTAAFEVVDQLGKAPDV
LAIPVGNAGNISAYWKGFKEYHAAGKSASLPKMLGFEAEGAMAIVKGEPIPNPETVATAI
RIGNPASWKTAVAAAEESGGQINYVTDEEILEAYRKIASREGIFAEPGSAASIAGVYKMK
REGYFKGGESVVCVLTGHGLKDPNIAISTVNAEPLVVSDTESAVMDAIAKLEGAARV
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatgaaggattgctgcaaacctacagagaatatttgccggtaaatgagcgtacc
ccgctgctaacgcttaaggaagggaataccccgctcatcaaagccgtgaatctatccgaa
gagctcggaatcgatttgcatttcaaattcgaagggctgaacccgacaggttcattcaaa
gaccgcgggatggtcatggccgtcgcgaaagcaatggaagaaggaagccgtaccatcatg
tgcgcttcgacgggcaatacatcggctgcggctgctgcttatgccgctcgcggcggatta
aactgcatcgtgatcattccgaacaacaatatcgcgctgggcaagctcgcgcaggcgatg
atttacggagcgaaggtgatcgcgattgaagggaactttgaccgcgcgctggaaatcgtt
cgcgagatcacggccaagcatccgatttcgctggtaaactccgtgaatccttatcgaatc
gaaggccagaagacggctgcattcgaagtcgttgaccagttgggcaaagctccggacgta
ctggccattccggtcggcaatgcggggaacatctccgcttactggaaaggatttaaagaa
taccacgcagcgggcaaatccgcttccctgccgaagatgcttgggttcgaggcggaaggc
gccatggctatcgtcaagggtgagcctattccgaatccggaaacggtagcgacggccatc
cgcatcgggaacccggccagctggaaaaccgcggttgccgccgctgaggaatccggtgga
caaattaactacgttacggacgaggaaatcttggaagcataccgcaaaatcgcatcgcgc
gaggggatttttgccgagccaggatcggccgcctccatcgcaggcgtttataaaatgaag
cgagagggatattttaaaggtggggaatccgttgtctgtgtgctgacaggacatgggctg
aaagatccgaatatcgcgatttctaccgtgaacgccgaaccgctcgtcgtatcggatacg
gaatcggccgtaatggatgccatcgctaagcttgaaggagctgcgcgggtatga

DBGET integrated database retrieval system