KEGG   Paenibacillus sp. Y412MC10: GYMC10_1812Help
Entry
GYMC10_1812       CDS       T01100                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:gym00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:gym00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2134506..2135990
Genome map
AA seq 494 aa AA seqDB search
MNLKQLSSVLAAAVIEGSGDVEITGIETDSRQVKPGDLFICLPGHTVDGHQFAAQAAGKG
AAALVVERKLEVDLPQVIVKDSRFAMAGLANAFYHQPSSRMKMIGVTGTNGKTTTTYLIE
TIMNDFGLKTGLIGTIQMKYGGQSFPMPRTTPEALELQRYLNDMANAGTECCVMEVSSHA
LEQGRVKGTDFRTAIFTNLTQDHLDYHHTMEEYRGAKGLFFSRLGNAFAKDESARKYAVL
NADDDASAYFAKQTAAEVITYGLGEDADVRASNISITAQGTSFHVDTFRGSADISIRMVG
KFNVYNAMAAIAAALLEGVPLEDIKNSLESVPGVDGRVEVVDEGQPYAVIVDYAHTPDGL
ENVLRTVNEFAEGRVLTVFGCGGDRDRTKRPIMGKIAAKYSDVVFVTSDNPRTEDPELIL
KDIEAGLVEDGVATESYKLIVDRRKAIEKAIEMASPGDVVLIAGKGHETYQLIAGEVLDF
DDRIVAKDAIRGRQ
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaaagcaattatcatccgtattggccgctgctgttatcgagggatccggagat
gttgaaattacggggatagaaacagactcaagacaagtaaaaccgggggatttgttcatt
tgcctgccgggccatacggtggatggacaccagtttgcagcccaggccgccggcaaaggc
gccgcggcgctggtcgttgaacgcaagctggaggttgacctcccgcaggtgatcgtgaaa
gacagccgcttcgcgatggcgggtttggcgaatgccttttatcatcagccgagctcccgc
atgaagatgatcggcgtaaccggtacgaacggcaagacaacgacaacgtatttgatcgag
acgatcatgaacgatttcgggttgaaaaccggattgatcggcacgattcagatgaaatac
ggcggccagtccttcccgatgccgagaacgacgcccgaggcgctggagcttcagcgttac
ttgaacgatatggccaatgcaggcaccgagtgctgcgtgatggaggtatcctcgcatgcg
ctcgaacaggggcgcgtgaagggaacggatttccggacggccatcttcacgaacctgacc
caggaccatctggactatcatcacacgatggaagaataccgcggcgcaaaagggttattt
ttctcccggctgggcaacgcttttgccaaggatgaatccgcgcgcaaatatgccgtcctg
aatgcggatgacgatgcttcggcatatttcgccaagcagaccgcggcggaagtgattacc
tacggtttgggtgaagatgcggatgtgcgggcgagcaatatatcgatcaccgcgcaaggc
acctcgttccatgtggatacgttccgcggcagtgcggacatttcgattcgaatggtaggg
aaattcaacgtgtataacgccatggctgcgatcgcggcagcgctcctggaaggtgtgccg
ctcgaagatatcaagaacagcctggaatccgttcccggagtcgatggccgcgtagaggtc
gtggatgaaggccagccgtatgccgtgatcgtggattatgcccatacgccggacggactt
gaaaatgtgctccgcaccgtcaatgaattcgcggaaggccgggtgctcaccgttttcggc
tgcgggggcgaccgggaccggaccaaacggccgatcatgggtaaaatcgctgcgaaatac
agcgacgttgtattcgtaacttccgataatccccgtaccgaggatccggagttgatattg
aaggatatcgaggccggattggttgaggacggtgtggcaaccgaaagctacaagctcatc
gtcgatcgccggaaagcgatcgaaaaggctattgaaatggcaagcccgggcgatgtagta
ttgattgcggggaaaggtcatgagacctatcagctgattgcgggcgaagtgcttgatttt
gacgaccgcatcgtagccaaagacgcgataaggggcagacaatag

DBGET integrated database retrieval system