KEGG   Paenibacillus sp. Y412MC10: GYMC10_1819Help
Entry
GYMC10_1819       CDS       T01100                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gym00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:gym00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2143160..2144443
Genome map
AA seq 427 aa AA seqDB search
MDKLVIEGGRPLSGTIRIHGAKNAALPILAASLLAEGTVRLSNVPHLLDIEVMLSILGRL
GSKCKHELETVTVDTSSANSFHVPEDLMKQMRSSIFLMGPLLARFGEVTIYQPGGCAIGE
RKIDLHLKGLQALGAEIEESNDKIHCRASRLIGTDIHLDFASVGATENIMMAAATALGTT
VLTNAAREPEIQDLQHFLNKMGANIIGAGTDTITIHGVERLEPCEYEIIPDRIVAGTVMI
AAAVTRGSVTLTKTNPSHLTSLIHVLKRAGVQTSICNDIINISCMSRPKAVERIVTSPYP
SFPTDLQSQVMVLLSLADGFSVMKETVFEGRFKHVEELSRMGADISTDLNYAFIRGVQRI
YGATVEATDLRAGAALVIAGLAAQGTTVVEQVHHIDRGYDRIENMFQGLGARIYRQTPVP
KPLDLAN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
ttggacaaattggtgattgagggcggaaggcccctatcaggaaccatacgtatccatgga
gcaaaaaatgcagctttacctattctagcagcaagtcttcttgcagaagggactgtaaga
ttaagcaatgtcccgcatctgctggatattgaagtgatgctcagcattctcggccgtctc
ggctccaaatgcaagcatgagctggagacggtgaccgtggatacctcgtcggccaattcg
tttcatgtcccggaagatttaatgaagcagatgcgatcctccatctttttgatgggacct
ctgctggcccgttttggcgaagtgacgatctaccagcccggaggctgcgcgatcggagaa
cgcaagatcgacctccatcttaaaggattgcaggcgcttggtgcggaaatcgaggagagc
aacgataagatccattgcagggccagccgtttgatcggaaccgatattcatctggatttt
gccagcgtgggggcgacggagaatatcatgatggcagctgcaacggcgctcggcacgacg
gtgctcaccaatgccgcgagagaacctgaaattcaggaccttcagcatttcctgaacaaa
atgggagcgaacattatcggggcaggaacggataccataacgatccatggcgtggagcgc
ctggagccttgcgagtatgagatcattccggacaggatcgtagccggaactgtcatgatc
gcagcagcggttacccgcggcagcgtaacgcttacaaagaccaatccgtcccatttaact
tcccttatacatgtgctgaagcgcgccggtgttcaaaccagtatatgcaatgatataata
aatataagctgcatgagccgtcctaaagctgtggaacgaatcgtgacttcgccgtatcct
tctttcccgactgatttgcaatcccaggtcatggtcttgctgtccttggcggacgggttt
agcgtgatgaaagagacggtattcgaaggacggttcaagcatgtggaggaactctcccgc
atgggggcggacatttctacggatctgaactatgcgttcatacgcggcgttcagagaatt
tacggagccaccgtggaagcaaccgatcttcgggctggagcggcgctcgtcattgccggt
ttggccgcgcagggaacgaccgtggtggagcaagttcaccatattgatcgcggttatgat
cgtattgaaaacatgttccaaggtttaggcgcacggatctatcgtcagacgccggtgcca
aagccgctagatttagccaattga

DBGET integrated database retrieval system