KEGG   Paenibacillus sp. Y412MC10: GYMC10_1992Help
Entry
GYMC10_1992       CDS       T01100                                 

Definition
transcriptional regulator/sugar kinase-like protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYMC10_1992
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC10_1992
   00052 Galactose metabolism
    GYMC10_1992
   00500 Starch and sucrose metabolism
    GYMC10_1992
   00520 Amino sugar and nucleotide sugar metabolism
    GYMC10_1992
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GYMC10_1992
   00524 Butirosin and neomycin biosynthesis
    GYMC10_1992
Enzymes [BR:gym01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GYMC10_1992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2328173..2329183)
Genome map
AA seq 336 aa AA seqDB search
MNRPDWDDPGSPSPPAPITITLDAGGTALKGALLVNGQLVPGSFLIRPSASQGTAEEAIA
SFAGACHDLLSFYASAFRPVDYRDSIRIGFAFPGPFDYAKGIALLQGIGKYDGLYKLSVR
DLLRSKFQSLKPSFPGAMMNRLTAADIRFGNDAFMFGLGASIRFRAERLVCLTLGTGLGS
AFVENGRIVAGKDGIPGSGMLYAEPYRDHIVDSYFGRRGILRMASERGLLTDGIDVADLA
EAATRGNGQARDLFREYGSNLGGMLRPYLSGFRPDRLVLGGQISGSLPLWERDMQLALGT
HSVPIDCLEDGTSAVFYGIEKLFDDTANDRSAPYYH
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgccctgattgggacgatccgggaagcccgtctccccctgcccccatcaccata
acgcttgatgccgggggaaccgctttgaagggggcgctgctcgtgaacgggcagcttgtc
cccggctcgttcctcatccggccttcggcatcgcaaggaacggcggaggaagcgatcgcc
agcttcgccggcgcctgccatgatttgttaagcttttacgcctcggccttccggccggtg
gactatcgcgattcgatccggatcggctttgcctttccggggcccttcgattacgcaaaa
ggcattgcccttcttcaaggcatcggcaaatatgatgggctgtacaaactgtcggttcgg
gatctgctccgttcgaagttccagagcctcaaaccatcctttccgggtgccatgatgaat
cgtttgaccgctgccgatatccggttcgggaacgacgccttcatgttcgggcttggcgcc
tccatccggttcagggcggaacgtctcgtatgcctgacgctcggtacgggcctcggttcc
gccttcgtggagaatggccggatcgtagccggcaaggacggtatccctggcagcggcatg
ctgtatgcggagccttaccgggaccacatcgtggacagctatttcgggagaagaggcatt
ctgaggatggcctcggagcggggactcctgacggacggaatcgacgtagccgatctggcc
gaagcggcaacgcgaggtaatgggcaggcccgcgatttattccgggaatacggcagcaat
ctgggaggaatgctgcggccctacctatccggattccggccggaccgcttggtgctgggc
ggacagatctcgggcagcttgcccttatgggaaagggatatgcagctggccttgggtacg
cacagcgttccaatcgactgtctcgaggacggtacgtccgctgtgttttacggcattgag
aagctgtttgacgatacggcgaacgatcgatccgctccatattatcattag

DBGET integrated database retrieval system