KEGG   Paenibacillus sp. Y412MC10: GYMC10_1998Help
Entry
GYMC10_1998       CDS       T01100                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym00220  Arginine biosynthesis
gym00330  Arginine and proline metabolism
gym01100  Metabolic pathways
gym01110  Biosynthesis of secondary metabolites
gym01130  Biosynthesis of antibiotics
gym01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    GYMC10_1998
   00330 Arginine and proline metabolism
    GYMC10_1998
Enzymes [BR:gym01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     GYMC10_1998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACX64279
JGI: GYMC10_1998
UniProt: D3E6B5
Position
complement(2335489..2336394)
Genome map
AA seq 301 aa AA seqDB search
MNNLPSTVSIIPVPFDRGATRRGAGQGPDAIFGAGLKRKLNALGVTYQVDDFAALPERKD
EAHHPRLKHLTEVVTMNEQLAARVSALAVAGTFPLVLGGDHSIAIGTLAGLTRHYRNLGV
IWIDAHSDLNTPDTTPTGNIHGMSLAVSLGKGDRRLTSIGGVKSTIKPEHVVLIGARSLD
QGERDFIRREGIACFTMQDIDRMGMFRVMEEAIRISSAGTDGVHLSFDIDSVDPKIAPGT
GTPVQGGLSYREAHLAMEMLSESGILTSAEFVENNPLLDRGQKTSRLLVGLIASMLGESI
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatcttccgtccaccgtatcgatcatcccggtgcccttcgaccggggagctacc
cgccgcggcgccggacagggaccggacgccatattcggagccggtctgaaacgcaagctt
aacgcgctcggtgtaacctaccaggtcgatgattttgctgcgctccccgagcgcaaggat
gaagcgcaccatccccgattaaaacatttgacagaagtcgtgacgatgaacgagcagctg
gcagcgcgcgtatccgccctggcagtagcgggcaccttccctcttgtgctcggcggcgac
catagcatagcaatcggcacgctcgccggacttacccggcattaccgcaacttgggcgtc
atctggatcgatgcccattccgatctcaatacgccggatactaccccgaccggcaatatc
catggcatgtccctggctgtcagcttgggaaaaggcgaccggcggctaacctcgatcggc
ggcgttaaatcaaccattaagccggagcatgtcgtgctcatcggcgcgcgctcacttgat
cagggcgagcgggacttcatccgccgggaaggcatcgcctgcttcacgatgcaggatatc
gaccgcatgggcatgttccgggtcatggaggaagccatccgcatatcgtcagcgggaacg
gatggcgttcacctctcctttgatatcgacagtgtcgacccgaagatcgcgccgggaaca
ggaacgccggttcaaggcgggctcagctaccgggaagcgcacctggccatggagatgctg
tcggaatccggtattctgacgtcagccgaattcgtggagaacaacccgctgctggaccgc
ggacagaagacgtcccggctgcttgtcggtttaatcgcctccatgctgggcgaaagcatc
ttatga

DBGET integrated database retrieval system