KEGG   Paenibacillus sp. Y412MC10: GYMC10_2063Help
Entry
GYMC10_2063       CDS       T01100                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym00010  Glycolysis / Gluconeogenesis
gym00071  Fatty acid degradation
gym00350  Tyrosine metabolism
gym00620  Pyruvate metabolism
gym00625  Chloroalkane and chloroalkene degradation
gym00626  Naphthalene degradation
gym00650  Butanoate metabolism
gym01100  Metabolic pathways
gym01110  Biosynthesis of secondary metabolites
gym01120  Microbial metabolism in diverse environments
gym01130  Biosynthesis of antibiotics
gym01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC10_2063
   00620 Pyruvate metabolism
    GYMC10_2063
   00650 Butanoate metabolism
    GYMC10_2063
  Lipid metabolism
   00071 Fatty acid degradation
    GYMC10_2063
  Amino acid metabolism
   00350 Tyrosine metabolism
    GYMC10_2063
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GYMC10_2063
   00626 Naphthalene degradation
    GYMC10_2063
Enzymes [BR:gym01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GYMC10_2063
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     GYMC10_2063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ACX64344
JGI: GYMC10_2063
UniProt: D3E6I0
Position
2408094..2410706
Genome map
AA seq 870 aa AA seqDB search
MAVSKGTTVEVKGQTAAEYIQGLIDKANRAKEKFMKLDQEQVDGIVQAMAMAGLEKHMQL
AKMAVEETGRGVYEDKIIKNLFATEYIHNSIKYDKTVGIIEDNAYDSFQKIAEPIGIIMG
ITPVTNPTSTTIFKALISIKTRNPIIFGFHPSAQACSREAALILRDAAVKQGAPADCIQW
IEAPSMDKTNTLMNHPDVACILATGGSAMVKAAYSCGKPALGVGPGNVPCFIEKSADLDQ
AVNDLILSKTFDNGMICASEQAVIIEEPIYHNVKKKMIASGCYFVNKEELAKLTAHAMVA
DKCAVNPTIVGQPAAKIAEACGFEVPESTKILVAELEGVGPAYPLSAEKLSPVLACYKVK
DAEEGITRAEEMVAFGGMGHSSVIHSHNEDVILKFSDRMKTCRILVNQPSSQGGIGDIYN
TNLPSLTLGCGSYGRNSTSSNVTAVNLINVKRVNRRTVNMQWFKVPDKIYFEKGSTQYLA
KMPDITRVAIVTDPMMVKLGYVERVEHYLRQRRLPVAIEVFSEVEPDPSTTTVERGTEML
ERFQPDCIIALGGGSPMDAAKAMWLFYEYPDTDFNNLKQKFMDIRKRVYKYPKLGRKAKF
VAIPTTSGTGSEVTSFAVITDKVQGNTKYPLADYELTPDVAIIDPEFVYTLPKTAVADTG
MDVLTHAIEAYVSVMASDYTDGLAIKAIQLVFQYLEQSALTGDKLAREKMHNASTLAGMA
FANAFLGINHSLAHKWGGQYHTAHGRTNAILMPHVIRYNAKKPTKFAAWPKYTHFVADER
YAEIARILGLPARTTEEGVNSLIAAIRELNSKLGIEESFQQLGIDPQDFERNVEHLADRA
FEDQCTTSNPKLPLVTELAEVYRNAFYGLF
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgagcaaaggaacaacggttgaagtgaagggacaaacggcagcagagtacatt
caaggtctgatcgacaaggcgaatcgggcaaaagaaaagtttatgaaactcgatcaggag
caagtcgacggaattgtgcaggccatggccatggccggacttgagaagcacatgcagctg
gcgaaaatggcggttgaagaaacgggccgcggcgtgtatgaagacaaaatcatcaaaaac
ctgtttgccacggagtatatccacaacagcatcaagtacgacaaaacggtaggtatcatc
gaagacaatgcctatgacagcttccaaaaaattgcggagccgatcgggatcatcatgggg
atcacaccggtaaccaatccgacctcgaccaccatattcaaggcgctgatctccatcaaa
acaagaaacccgatcatcttcggtttccatccatccgcgcaggcatgcagcagggaggcc
gcgctcatcctgcgggacgccgccgtgaaacaaggcgctccggccgactgcatccagtgg
atcgaggctccttccatggataaaaccaatacactcatgaaccatcctgacgttgcctgc
attctggctacgggcggatcggcgatggtcaaagcagcatacagctgcggcaagccagcc
ctcggcgtaggtcccggcaacgtgccgtgcttcatcgagaaaagcgcggacctcgatcaa
gcggtgaacgacttgattttgtccaagacgtttgataacggcatgatctgcgcatccgaa
caagcggtcattatcgaggagccgatctatcataacgtgaagaaaaaaatgatcgccagc
ggctgttatttcgtgaacaaggaagagctggcgaagctgactgcgcatgccatggtagcg
gataaatgcgccgtcaatcctaccatcgtcggacagccggcagccaagattgccgaggct
tgcggctttgaggtaccggaaagcaccaagattctggtcgccgagctggagggagtcggt
cctgcttatccgttgtccgccgagaagctgagcccggtgctggcctgctataaagtgaaa
gatgcggaagagggcatcacgcgcgccgaagagatggttgcttttggcggcatgggccac
tcgtcggtcatccactcgcacaatgaggacgtcatcctgaaattctcggatcgcatgaag
acctgccgcatcctggtcaaccagccttcttcgcaaggcggcatcggggatatctacaac
acgaacctgccatcgctgacgctcggctgcggttcgtatggccggaattccacgtcgtcg
aacgtgacggccgtcaatctcatcaacgtgaaaagggtgaaccgcagaaccgtgaatatg
cagtggtttaaagtgccggacaaaatttactttgaaaaaggctcgacgcagtatctcgcc
aaaatgcctgacatcacccgcgtcgcgatcgtaaccgaccccatgatggtgaagctggga
tatgtggagcgggtagagcattacctgcgtcagcgcagactgccggtagccatcgaggtg
ttctcggaagtcgagccggatccttcgacaacgaccgttgaacggggtacggagatgctg
gaacggttccagccggactgcatcatcgcccttggcggcggatcgcctatggatgccgca
aaagcgatgtggctgttctatgaatatccggatacggacttcaacaacctgaagcaaaaa
ttcatggatatccgcaaacgggtctataaatatccgaagctgggacggaaggcgaaattc
gtagccattccgacaacgtcgggaacgggctcggaagtaacttcgtttgccgtcatcacg
gacaaagtgcagggaaataccaaatacccgctggcagactatgagctgacgccggacgtg
gcgatcatcgatccggaattcgtgtacaccttgcctaaaacggcggtggccgataccggc
atggacgtcctgacgcatgcgattgaagcctacgtatcggtgatggctagcgattacacg
gatgggcttgccatcaaagccatccagctggtgttccagtatcttgagcaatcggcgctg
accggcgacaaactcgcccgcgagaaaatgcataatgcttcgacgcttgcaggcatggcc
tttgcgaacgcgttcctgggcatcaatcacagtcttgcgcataaatgggggggacagtac
catacggcgcatggacggaccaatgccatactgatgccgcacgtcattcgctacaatgcc
aagaagccaacgaaattcgcggcatggccgaagtacacccactttgtggccgatgaaaga
tatgccgagatcgcacggattcttggactgccggcaagaacgacggaggagggtgtaaac
agcctgatcgccgccatccgcgagctgaacagcaaactcggcatcgaggaatcgttccag
cagctgggcatcgatccacaggacttcgagagaaacgtcgagcatttggcggaccgggct
ttcgaagatcagtgcacgaccagcaatcccaagctgccgctggtgacagagcttgcagaa
gtatatcgcaacgccttctatggacttttctaa

DBGET integrated database retrieval system