KEGG   Paenibacillus sp. Y412MC10: GYMC10_2211Help
Entry
GYMC10_2211       CDS       T01100                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gym01100  Metabolic pathways
gym01110  Biosynthesis of secondary metabolites
gym01130  Biosynthesis of antibiotics
gym01230  Biosynthesis of amino acids
Module
gym_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GYMC10_2211
Enzymes [BR:gym01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     GYMC10_2211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh His_biosynth
Motif
Other DBs
NCBI-ProteinID: ACX64491
JGI: GYMC10_2211
UniProt: D3E7K7
Position
2547107..2547916
Genome map
AA seq 269 aa AA seqDB search
MYLDRIVETKRNEVAQLRETFSISEAERQIADLPPTLGFEKALSMGRKRSMGLIAEVKKA
SPSKGLIRPDFDPVMIAKAYEAADADCLSVLTDKDYFQGSGEYLQAVRAAVNIPLLRKDF
IIDETQIYEARLLGADAVLLIASILAPQRIAEFIDVAGSIGLDCLIEVHDGQELESVLGL
GTARLIGINNRNLRTFETSLQTTADIAAQVPEEVTLISESGISSPADISYLHYVGAHGVL
VGEHFMRQQDVFRAVNDLMGPLPIAADME
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtatcttgatcgaatcgtagaaacgaaacgcaatgaggttgcacagctgcgagaaacg
ttcagcatctcggaagcagagaggcaaatagcggatttgcctccgactctcgggtttgag
aaggcgttgtccatgggacgcaaacgcagcatggggttaatcgccgaggtcaaaaaggct
tcgccctccaaagggttgattcgtcccgactttgacccggttatgatcgccaaggcttac
gaagcagccgatgccgattgtctgtccgtgctgacggataaggattactttcagggaagt
ggagaatatttgcaagcggtaagggcggccgtcaacatcccgctgctgcgcaaagatttc
attatcgacgagactcagatttacgaagcgcgcctgctgggtgcggacgccgttctcttg
attgcgagcatccttgcgccgcagcgtatcgcggagttcattgacgttgcaggctcgatc
ggattggattgcctgattgaggttcacgatgggcaagagctggaatcggtactcggactg
ggaacggcccggctgatcgggattaacaaccgtaatcttcggacctttgaaacctcattg
cagacaacggcagatatcgcggcgcaggttccggaggaagtgacgctgatcagcgaaagt
ggaatatcgagcccggccgacatatcctacttgcattatgtgggagcacacggggttctg
gtcggggaacatttcatgcgccagcaggacgtgttccgcgctgtgaacgatctgatggga
ccgctgccgatagctgcagacatggaataa

DBGET integrated database retrieval system