KEGG   Paenibacillus sp. Y412MC10: GYMC10_2213Help
Entry
GYMC10_2213       CDS       T01100                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GYMC10_2213
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GYMC10_2213
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GYMC10_2213
Enzymes [BR:gym01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GYMC10_2213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2548600..2549796
Genome map
AA seq 398 aa AA seqDB search
MTQLPDRNGRFGVFGGRFVPETLMNALIELEQEYNRFSEDPAFKEEIAYLLKQYSGRETP
LYYAERLSQHLGKAKIYLKREDLNHTGAHKINNAIAQGVLAKRMGKGKVIAETGAGQHGV
ATATVAALLGLECKVFMGEEDTKRQQLNVFRMKMLGAEVIPVTSGSRTLKDAGNEALRYW
VSNVEDTFYVLGSAVGPHPYPMMVRNFQRIIGDETRRQILETEGRLPNVILAPIGGGSNA
IGMFYPFLEDKEVGLIGVEAAGKGVDTDFHAATMSKGTQGVFQGSMSYLLQDEYGQVQEA
HSISAGLDYPGVGPEHSYLKDIERVQYVPITDQEALDALQLLCRTEGIIPALESAHAVAQ
AVKMASTWTENDIVVINLSGRGDKDVESIMAYTGGKTE
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcttcctgaccgtaatggacgtttcggggtgtttggaggccggttcgtgccg
gaaacactgatgaacgctttaatagagcttgagcaagaatataatcgtttttcggaggat
cctgcttttaaagaggagatcgcctatttgctgaaacagtattccggaagggaaacgccg
ctttattacgcggagcggctcagccaacatctcggcaaggctaaaatttacctgaagcgc
gaggatttgaaccataccggcgcgcacaaaatcaacaacgccattgcacaaggcgtgtta
gccaagcgcatgggcaaaggcaaggtcattgccgaaacgggcgccggacagcatggcgta
gcgaccgcgacggtagccgctctgctgggtcttgaatgcaaggtatttatgggcgaagaa
gataccaaacggcagcagttgaacgtattccgcatgaaaatgctcggtgccgaagtaatt
ccggtcacgtcgggaagccgaacgctgaaagatgccggcaacgaggcgcttcgctactgg
gtcagcaacgtcgaggataccttttatgtgctgggctccgctgtagggccgcatccttat
ccgatgatggtgcggaacttccagcgcattatcggtgacgagacccggaggcagatactg
gagacggaaggaaggcttccaaacgtcattcttgcgccgatcgggggcggtagcaatgcg
atcggcatgttctatccgtttcttgaagacaaggaagtcggtttgatcggcgtcgaagcg
gcaggcaagggagtggataccgattttcatgcggctacgatgtccaaggggacacaaggc
gtattccaaggctcgatgagttatttgctgcaggacgagtacggacaagtacaggaagcg
cattccatttcagccggccttgattatcccggcgttggcccggagcattcctatttaaaa
gacattgagcgtgtgcagtacgtaccgataaccgaccaagaggcgctcgatgccctgcag
ctgctatgccgcacggaaggcattattcctgccctggaatccgcgcacgccgtagcgcaa
gccgtaaagatggcatctacgtggaccgagaacgatattgttgtgattaatttatccggt
cgcggcgacaaggacgtggagtccatcatggcttacacgggagggaaaaccgaatga

DBGET integrated database retrieval system