KEGG   Paenibacillus sp. Y412MC10: GYMC10_2214Help
Entry
GYMC10_2214       CDS       T01100                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym00260  Glycine, serine and threonine metabolism
gym00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gym01100  Metabolic pathways
gym01110  Biosynthesis of secondary metabolites
gym01130  Biosynthesis of antibiotics
gym01230  Biosynthesis of amino acids
Module
gym_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GYMC10_2214
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GYMC10_2214
Enzymes [BR:gym01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GYMC10_2214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth PcrB NMO
Motif
Other DBs
NCBI-ProteinID: ACX64494
JGI: GYMC10_2214
UniProt: D3E7L0
Position
2549793..2550599
Genome map
AA seq 268 aa AA seqDB search
MNRIDQTFASLKQQNKTAMIPYLTVGDPDVKSTLDIIHELEIAGADIIELGVPYSDPLAD
GPVIQRASERALKSKVTIRTCMETARLARERGSKLPFILFTYYNPVLQTGLDVFFEEVVR
HDISGLIIPDLPVEESEEVRKRAHAAGVHLIPLVAPTSHERIASIASEATGFVYCVSSLG
VTGERTDFYSGVESFLETVRQYSSVPIAIGFGISSSEQVARFSKICDGVVVGSAIVRQIE
STIPLLEKEETRQQGLLQIREFVAQLKG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaatcgatcagacctttgcgtcgttgaagcaacaaaacaagaccgccatgatc
ccttatctcactgtcggggatccggatgtgaagtcgacgctggatatcatccatgagctt
gaaatcgcgggagccgacattattgaactcggcgttccttactcggatccccttgccgac
ggaccggtcattcagcgagcttccgagcgcgcgctgaagagcaaggtgaccattcgcact
tgcatggaaaccgcgcgcctggcaagagagcggggcagcaagctgccgttcatcctgttc
acgtattacaatccggtactgcaaaccggactggacgttttcttcgaggaagtggtaagg
cacgacatcagcggcttgatcattcccgatcttccggtggaggaatccgaggaggttcgg
aaacgcgcccacgcggcgggcgttcatctgataccgctggtggcccctacctcccatgag
cggattgcgagcatcgcttcggaagcgaccggctttgtgtactgcgtatcctcgcttggc
gtgacgggcgagcgcaccgatttttactcgggggtggagtcttttcttgagacggtaagg
cagtacagcagcgtgccgatcgcgatcggctttggcatttcatccagtgagcaggtggcc
agattttccaaaatctgcgacggcgtcgttgtcggcagcgcgattgtgcgtcagattgaa
tcgaccattcctctgttggagaaggaagagacaagacagcaggggcttttgcaaatcagg
gagtttgtggcacaattaaaaggatag

DBGET integrated database retrieval system