KEGG   Paenibacillus sp. Y412MC10: GYMC10_2406Help
Entry
GYMC10_2406       CDS       T01100                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gym00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:gym00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2748513..2749001
Genome map
AA seq 162 aa AA seqDB search
MISMIWAMGKDQVIGLNGTMPWRLPRDMAFFKEKTLHKTILMGRKTWDSFGGKPLPHRKN
IVLTRDESFTLTEDQGIVIHDIENALPYSKNEELMVIGGSQIYELMLPKADRLYCTFIDE
SFEGDTYFPEVNWDEWKIVEEVPGITDEKNPYAYRFVTFERK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatatcgatgatatgggcaatgggcaaggatcaggtgatcgggctgaacggcacgatg
ccgtggcgcttgccgcgggatatggccttcttcaaggagaaaaccctccataaaacgatc
ctgatggggcgcaagacttgggattcctttggcggcaagccgctgcctcaccgaaagaac
atcgtgctgacgagagatgagagctttacgttgacggaggatcagggcatcgtgatccat
gacatcgagaacgcgttaccctattcgaagaatgaggaactgatggtgattggcggatcg
cagatttatgaattgatgctgccgaaagcggatcgtctgtactgcacgttcattgacgag
agttttgaaggggatacgtactttcccgaagtgaactgggatgaatggaagatcgtcgaa
gaagttcccggcatcacggatgaaaaaaatccgtatgcctaccgtttcgttacgtttgaa
cggaaataa

DBGET integrated database retrieval system