KEGG   Paenibacillus sp. Y412MC10: GYMC10_2418Help
Entry
GYMC10_2418       CDS       T01100                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GYMC10_2418
Enzymes [BR:gym01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     GYMC10_2418
Exosome [BR:gym04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GYMC10_2418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2762894..2764900
Genome map
AA seq 668 aa AA seqDB search
MNQAVREGNMTPEQVYLFHEGTWFHSYQCMGAHLATEEGEEGVRFTVWAPNARQVGLAGD
WNGWDGSQDPLYRMPDSGIWSRFFPGMETGTFYKYQITGPFGETFLKADPYAFHAEVRPA
TASVVTDLSGYRWNDAAWRRKNKSPYAKPVNIYEMHFGTWRQKEDGSFFTYRELADQLIP
YLQEMSYTHVEFMPLAEHPYDLSWGYQGTGFYALTSRYGTPHDFMFLVDQLHQAGIGVLL
DWVPAHFAKDAHGLRQFDGAPLYEYADPQKAEKPGWGTLSFDYAKPEVISFLISNALFWM
DMYHIDGLRVDAVTSMIRLDFEKREGQYSLNEHGGLENLEAISFLQELNKAVFRYYPNAL
MMAEESSAWAGVTAPVHEGGLGFNYKWNMGWMNDTLSYIEQEFDQRPTHHNLLTFPICYA
YSENFTLPLSHDEVVHGKKSLLNKMPGSYEQKFAGLRILLGYQITQPGKNLLFMGGEFGQ
FIEWKDQEQLDWLLLDYESHRKQLAYTAALNRMYVDEKALWEQDHRWEGFEWLSADDHEQ
SVVSYMRMGTKPGDTLIIVINFQPKAYDQYRVGLPRAGQYVEILNSDHADYGGSGLLNDG
EMKAEKKTWHGQTHSLEIKLPPLGMVVLKKKPPRSRKSQDRSDASLKAAAAREKTEQKTK
RSKRGKQD
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccaagcagttagggaaggaaacatgactccggaacaagtgtatttatttcatgaa
ggaacctggtttcacagttaccaatgtatgggtgcacaccttgccacagaagaaggagaa
gagggcgtgcgttttacggtgtgggctccgaatgccaggcaggtaggacttgccggagac
tggaacggctgggatggttcccaagacccgttatataggatgcccgattcgggaatttgg
agtcggtttttccctgggatggagactggaactttttacaaatatcagatcacggggccc
ttcggagaaacattcctaaaggccgatccttatgcatttcatgccgaagtacgacctgcg
acggcatcggtggtgaccgacctctcaggatatcgctggaatgatgccgcatggagaagg
aagaacaaatccccatatgccaagccggtgaacatttatgaaatgcacttcggaacctgg
cggcaaaaagaggacggttcgttctttacatatcgggaattggccgatcagctgattcct
tatttgcaggaaatgagttatacccacgtagaatttatgcccttggcggagcatccctac
gatctttcgtggggctatcagggcacaggattttatgcgctgacgagcagatacggaact
ccccatgatttcatgtttctcgtcgaccagctgcaccaagccggcatcggcgtgctgctc
gactgggtgcccgcacattttgccaaggatgcccacgggcttcggcagtttgacggggcg
cctctttatgagtatgcagacccccaaaaagccgagaaacctggctggggaacattgtct
ttcgattatgccaagccggaggtaatttcattcctcatctccaatgccttattttggatg
gatatgtatcatattgatggtcttcgcgttgatgccgtgacgagcatgatccgtcttgat
tttgagaagcgtgagggtcagtacagccttaacgagcacggaggcttggaaaaccttgag
gcgatatcctttctgcaggaattgaataaagccgtgtttcgatattacccgaatgccttg
atgatggccgaggagtcgagcgcatgggcgggggttacggcacctgtgcatgaagggggt
cttggcttcaattacaaatggaatatgggctggatgaacgacacgctgtcttatattgaa
caagagttcgatcagcggcctacccatcataatttactgacatttcccatttgttatgcc
tattcggagaattttacattgccgctttcacacgatgaagtcgtccatggaaagaaatcg
ctgcttaataaaatgccgggaagctacgaacaaaagtttgcgggactgcggattttgctt
ggataccagatcacccagcccgggaagaatctgctgttcatggggggagagttcggccag
tttatcgaatggaaggatcaggagcagctcgactggctgctgctggactatgaaagccac
cgcaagcagttggcatatacggcagctctaaaccgcatgtacgtggatgaaaaggcgcta
tgggagcaggatcaccgatgggaaggcttcgaatggctcagcgccgatgatcatgagcag
agtgtcgtatcgtatatgagaatgggcaccaagcccggcgatacgctgatcatcgtcatt
aattttcagccaaaggcatatgaccaatatcgggtcggtttgccgagagcggggcaatat
gtggaaattctgaattccgatcatgccgattacggcggctccggactgctgaacgacggt
gagatgaaagcggagaagaagacctggcatggccaaacccacagcctggagatcaagctg
cctccattaggcatggttgttttaaagaaaaagccgcctcgatcgaggaaatcgcaagat
cgatcggacgcgtcgctgaaggcggcagcggcaagagagaaaacagaacaaaaaacgaaa
cggagcaaaagggggaagcaggattga

DBGET integrated database retrieval system